Property Summary

NCBI Gene PubMed Count 5
PubMed Score 7.12
PubTator Score 17.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
periodontitis 280 9.2e-10
cystic fibrosis 1629 1.6e-04
nasopharyngeal carcinoma 1024 7.7e-04
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 1.0
Endometrial cancer 301 0.0 0.5

Expression

  Differential Expression (3)

Disease log2 FC p
cystic fibrosis -2.400 1.6e-04
nasopharyngeal carcinoma -2.300 7.7e-04
periodontitis -1.200 9.2e-10

Gene RIF (3)

AA Sequence

MAQLLNSILSVIDVFHKYAKGNGDCALLCKEELKQLLLAEFGDILQRPNDPETVETILNLLDQDRDGHID      1 - 70
FHEYLLLVFQLVQACYHKLDNKSHGGRTSQQERGQEGAQDCKFPGNTGRQHRQRHEEERQNSHHSQPERQ     71 - 140
DGDSHHGQPERQDRDSHHGQSEKQDRDSHHSQPERQDRDSHHNQSERQDKDFSFDQSERQSQDSSSGKKV    141 - 210
SHKSTSGQAKWQGHIFALNRCEKPIQDSHYGQSERHTQQSETLGQASHFNQTNQQKSGSYCGQSERLGQE    211 - 280
LGCGQTDRQGQSSHYGQTDRQDQSYHYGQTDRQGQSSHYSQTDRQGQSSHYSQPDRQGQSSHYGQMDRKG    281 - 350
QCYHYDQTNRQGQGSHYSQPNRQGQSSHYGQPDTQDQSSHYGQTDRQDQSSHYGQTERQGQSSHYSQMDR    351 - 420
QGQGSHYGQTDRQGQSSHYGQPDRQGQNSHYGQTDRQGQSSHYGQTDRQGQSSHYSQPDKQGQSSHYGKI    421 - 490
DRQDQSYHYGQPDGQGQSSHYGQTDRQGQSFHYGQPDRQGQSSHYSQMDRQGQSSHYGQTDRQGQSSHYG    491 - 560
QTDRQGQSYHYGQTDRQGQSSHYIQSQTGEIQGQNKYFQGTEGTRKASYVEQSGRSGRLSQQTPGQEGYQ    561 - 630
NQGQGFQSRDSQQNGHQVWEPEEDSQHHQHKLLAQIQQERPLCHKGRDWQSCSSEQGHRQAQTRQSHGEG    631 - 700
LSHWAEEEQGHQTWDRHSHESQEGPCGTQDRRTHKDEQNHQRRDRQTHEHEQSHQRRDRQTHEDKQNRQR    701 - 770
RDRQTHEDEQNHQR                                                            771 - 784
//

Text Mined References (6)

PMID Year Title