Property Summary

NCBI Gene PubMed Count 32
PubMed Score 21.86
PubTator Score 105.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung cancer 4473 4.3e-02
Disease Target Count Z-score Confidence
Takayasu's arteritis 54 3.438 1.7

Expression

  Differential Expression (1)

Disease log2 FC p
lung cancer -3.100 4.3e-02

Gene RIF (6)

PMID Text
25604533 RPS9/LILRB3 (rs11666543) was associated with Takayasu arteritis.
23285058 Evaluating different RPS9 fragments for their ability to bind NPM1 indicated that there are two binding sites for NPM1 on RPS9.
23125841 Tandem affinity purification and mass spectrometry analysis identify ribosomal protein S9 (RPS9), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
20221446 ribosomal protein S9 silencing elicits a multitude of cellular responses inhibiting the growth of cancer cells subsequent to p53 activation
19834535 Observational study of gene-disease association. (HuGE Navigator)
18420587 B23 selectively stores, and protects ribosomal protein S9 in nucleoli and therefore could facilitate ribosome biogenesis.

AA Sequence

MPVARSWVCRKTYVTPRRPFEKSRLDQELKLIGEYGLRNKREVWRVKFTLAKIRKAARELLTLDEKDPRR      1 - 70
LFEGNALLRRLVRIGVLDEGKMKLDYILGLKIEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQ     71 - 140
VVNIPSFIVRLDSQKHIDFSLRSPYGGGRPGRVKRKNAKKGQGGAGAGDDEEED                    141 - 194
//

Text Mined References (41)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25604533 2015 Identification of Susceptibility Loci in IL6, RPS9/LILRB3, and an Intergenic Locus on Chromosome 21q22 in Takayasu Arteritis in a Genome-Wide Association Study.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23285058 2012 Elucidation of motifs in ribosomal protein S9 that mediate its nucleolar localization and binding to NPM1/nucleophosmin.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21269460 2011 Initial characterization of the human central proteome.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20221446 2010 Silencing of ribosomal protein S9 elicits a multitude of cellular responses inhibiting the growth of cancer cells subsequent to p53 activation.
19946888 2010 Defining the membrane proteome of NK cells.
19834535 2009 Sequential use of transcriptional profiling, expression quantitative trait mapping, and gene association implicates MMP20 in human kidney aging.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18420587 2008 Ribosomal protein S9 is a novel B23/NPM-binding protein required for normal cell proliferation.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17289661 2007 Molecular composition of IMP1 ribonucleoprotein granules.
17220478 2007 Proteomics analysis of the interactome of N-myc downstream regulated gene 1 and its interactions with the androgen response program in prostate cancer cells.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15883184 2005 Mass spectrometric analysis of the human 40S ribosomal subunit: native and HCV IRES-bound complexes.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15189156 2004 The molecular mechanics of eukaryotic translation.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12588972 2003 Transcript-selective translational silencing by gamma interferon is directed by a novel structural element in the ceruloplasmin mRNA 3' untranslated region.
12565890 2003 Centaurin-alpha 1 associates in vitro and in vivo with nucleolin.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11875025 2002 The human ribosomal protein genes: sequencing and comparative analysis of 73 genes.
11790298 2002 Directed proteomic analysis of the human nucleolus.
11751223 2001 Differential expression of genes coding for ribosomal proteins in different human tissues.
11044901 2000 Identification of genes responsive to BPDE treatment in HeLa cells using cDNA expression assays.
9582194 1998 A map of 75 human ribosomal protein genes.
8722009 Structure and evolution of mammalian ribosomal proteins.
8706699 1996 Characterization of the human small-ribosomal-subunit proteins by N-terminal and internal sequencing, and mass spectrometry.
8318536 1993 Structural arrangement of the codon-anticodon interaction area in human placenta ribosomes. Affinity labelling of the 40S subunits by derivatives of oligoribonucleotides containing the AUG codon.
7772601 1995 Cloning, sequencing and expression of the L5, L21, L27a, L28, S5, S9, S10 and S29 human ribosomal protein mRNAs.