Property Summary

NCBI Gene PubMed Count 25
PubMed Score 67.99
PubTator Score 22.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

Gene RIF (2)

PMID Text
23125841 Tandem affinity purification and mass spectrometry analysis identify ribosomal protein S8 (RPS8), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
21371428 RPS8, a member of the small subunit ribosome, was identified as an interacting partner of CDK11p46.

AA Sequence

MGISRDNWHKRRKTGGKRKPYHKKRKYELGRPAANTKIGPRRIHTVRVRGGNKKYRALRLDVGNFSWGSE      1 - 70
CCTRKTRIIDVVYNASNNELVRTKTLVKNCIVLIDSTPYRQWYESHYALPLGRKKGAKLTPEEEEILNKK     71 - 140
RSKKIQKKYDERKKNAKISSLLEEQFQQGKLLACIASRPGQCGRADGYVLEGKELEFYLRKIKARKGK      141 - 208
//

Text Mined References (34)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21371428 2011 CDK11p46 and RPS8 associate with each other and suppress translation in a synergistic manner.
21269460 2011 Initial characterization of the human central proteome.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17289661 2007 Molecular composition of IMP1 ribonucleoprotein granules.
17220478 2007 Proteomics analysis of the interactome of N-myc downstream regulated gene 1 and its interactions with the androgen response program in prostate cancer cells.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15883184 2005 Mass spectrometric analysis of the human 40S ribosomal subunit: native and HCV IRES-bound complexes.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15189156 2004 The molecular mechanics of eukaryotic translation.
12588972 2003 Transcript-selective translational silencing by gamma interferon is directed by a novel structural element in the ceruloplasmin mRNA 3' untranslated region.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11790298 2002 Directed proteomic analysis of the human nucleolus.
9582194 1998 A map of 75 human ribosomal protein genes.
8764399 1996 Intron-encoded, antisense small nucleolar RNAs: the characterization of nine novel species points to their direct role as guides for the 2'-O-ribose methylation of rRNAs.
8722009 Structure and evolution of mammalian ribosomal proteins.
8706699 1996 Characterization of the human small-ribosomal-subunit proteins by N-terminal and internal sequencing, and mass spectrometry.
8432552 1993 The structure of the human intron-containing S8 ribosomal protein gene and determination of its chromosomal location at 1p32-p34.1.
1712897 1991 Ribosomal protein genes are overexpressed in colorectal cancer: isolation of a cDNA clone encoding the human S3 ribosomal protein.