Property Summary

NCBI Gene PubMed Count 38
PubMed Score 107.76
PubTator Score 101.46

Knowledge Summary

Patent (10,769)

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Breast Neoplasms 423 0.0 0.0
Disease Target Count
Mammary Neoplasms 403
Disease Target Count P-value
psoriasis 6514 2.0e-04
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.7
Disease Target Count Z-score Confidence
Kleine-Levin syndrome 6 4.984 2.5
Craniosynostosis 73 3.958 2.0
Mediastinitis 7 3.313 1.7

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 2.100 2.0e-04

Protein-protein Interaction (4)

Gene RIF (25)

AA Sequence

MAAVFDLDLETEEGSEGEGEPELSPADACPLAELRAAGLEPVGHYEEVELTETSVNVGPERIGPHCFELL      1 - 70
RVLGKGGYGKVFQVRKVQGTNLGKIYAMKVLRKAKIVRNAKDTAHTRAERNILESVKHPFIVELAYAFQT     71 - 140
GGKLYLILECLSGGELFTHLEREGIFLEDTACFYLAEITLALGHLHSQGIIYRDLKPENIMLSSQGHIKL    141 - 210
TDFGLCKESIHEGAVTHTFCGTIEYMAPEILVRSGHNRAVDWWSLGALMYDMLTGSPPFTAENRKKTMDK    211 - 280
IIRGKLALPPYLTPDARDLVKKFLKRNPSQRIGGGPGDAADVQRHPFFRHMNWDDLLAWRVDPPFRPCLQ    281 - 350
SEEDVSQFDTRFTRQTPVDSPDDTALSESANQAFLGFTYVAPSVLDSIKEGFSFQPKLRSPRRLNSSPRA    351 - 420
PVSPLKFSPFEGFRPSPSLPEPTELPLPPLLPPPPPSTTAPLPIRPPSGTKKSKRGRGRPGR            421 - 482
//

Text Mined References (44)

PMID Year Title