Property Summary

Ligand Count 269
NCBI Gene PubMed Count 277
PubMed Score 0.00
PubTator Score 796.60

Knowledge Summary

Patent (50,455)

Expression

  Differential Expression (6)

Disease log2 FC p
group 3 medulloblastoma 1.100 1.6e-03
osteosarcoma 1.189 2.3e-04
ovarian cancer -1.500 2.0e-05
Pick disease -1.100 9.3e-03
progressive supranuclear palsy -1.100 3.8e-02
psoriasis 1.400 9.8e-04

Gene RIF (230)

AA Sequence

MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVGPYELGMEHCE      1 - 70
KFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIFAMKVLKKAMIVRNAKDTAHT     71 - 140
KAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLH    141 - 210
QKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLG    211 - 280
ALMYDMLTGAPPFTGENRKKTIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHP    281 - 350
FFRHINWEELLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLE    351 - 420
SVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSGIEQMDVTMSG    421 - 490
EASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL                                       491 - 525
//

Text Mined References (292)

PMID Year Title