Property Summary

Ligand Count 273
NCBI Gene PubMed Count 277
PubMed Score 0.00
PubTator Score 796.60

Knowledge Summary

Patent (50,455)


  Differential Expression (6)

Disease log2 FC p
group 3 medulloblastoma 1.100 1.6e-03
osteosarcoma 1.189 2.3e-04
ovarian cancer -1.500 2.0e-05
Pick disease -1.100 9.3e-03
progressive supranuclear palsy -1.100 3.8e-02
psoriasis 1.400 9.8e-04

PDB (18)

Gene RIF (230)

AA Sequence

EASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL                                       491 - 525

Text Mined References (292)

PMID Year Title