Property Summary

NCBI Gene PubMed Count 248
PubMed Score 0.00
PubTator Score 796.60

Knowledge Summary

Patent (50,455)

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis 1.400 9.8e-04
osteosarcoma 1.189 2.3e-04
group 3 medulloblastoma 1.100 1.6e-03
Pick disease -1.100 9.3e-03
progressive supranuclear palsy -1.100 3.8e-02
ovarian cancer -1.500 2.0e-05

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
588725 other 0 / 0 / 1 Late stage counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): Radioactivity-based biochemical assay to identify modulators of a panel of 48 kinases
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (201)

PMID Text
26818518 This study report that protein levels of the p70 S6 kinase was increased in Progressive Supranuclear Palsy and Corticobasal Degeneration brains.
26626074 Our results suggest that silencing of AT1R inhibits EMT induced by HG in HK-2 cells via inactivation of mTOR/p70S6K signaling pathway.
26514620 Collectively, our findings suggested that both in vitro and in vivo differentiation of Th17 cells were positively regulated by p70(S6K1)
26506538 Our study indicated that Microcystin-LR exposure promoted HL7702 cell proliferation and the main mechanism was the activation of Akt/S6K1 cascade.
26468204 These data suggest that S6K1 may represent a molecular link between aging and Alzheimer disease.
26427479 Results suggest that blocking both the mTOR kinase downstream targets 4E-BP1 protein and p70 S6 kinase 1, but not p70 S6 kinase 1 alone, prevents the migration of retinal pigment epithelium (RPE) cells.
26362858 These results indicate that the inhibitory effect of rapamycin may be due mainly to increased p14, p15, and p57 expression via promoter demethylation and decreased mTOR and p70S6K expression in ALL cell lines.
26238185 MiR-497 decreases cisplatin resistance in ovarian cancer cells by targeting mTOR/P70S6K1.
26235873 Inactivated Sendai virus induces apoptosis and autophagy via the PI3K/Akt/mTOR/p70S6K pathway in human non-small cell lung cancer cells.
26172298 eIF3 has a role in controlling cell size independently of S6K1-activity
26169935 Data show that leucine alone stimulates mTORC1 signaling and ribosomal protein s6 kinase 1 (S6K1) phosphorylation.
26080838 The newly identified miR-195-RPS6KB1 axis partially illustrates the molecular mechanism of prostate cancer progression and represents a novel potential therapeutic target for prostate cancer treatment.
25846498 This is the first study highlighting the activation of S6K1 by palmitic acid as a common and novel mechanism by which its inhibition by oleic acid prevents endoplasmic reticulum stress, lipoapoptosis and insulin resistance in hepatocytes.
25784113 A higher SUVmax on 18F-FDG PET is associated with elevated tumor levels of pAkt and pS6 protein and with aggressive behavior and metastatic potential of RCC, as well as with early relapse following radical nephrectomy and shorter overall survival.
25762619 mTORC1 regulates cell adhesion through S6K1 and 4E-BP1 pathways, but mTORC2 regulates cell adhesion via Akt-independent mechanism
25659153 Tanshinone IIA inhibits HIF-1alpha and VEGF expression in breast cancer cells via mTOR/p70S6K/RPS6/4E-BP1 signaling pathway.
25635535 Arg-II, p38, and S6K1 form a positive circuit which regulates endothelial senescence and cardiovascular aging.
25600244 pS6 expression is associated with the characteristics of a high Ki-67 subset in ER+ and HER2- breast cancer whose proliferation seemed to be affected by activation possibly of the mTOR/S6 pathway.
25379021 Resistance to Selumetinib (AZD6244) in colorectal cancer cell lines is mediated by p70S6K and RPS6 activation.
25356520 Data suggest that potent, selective, and cell permeable S6 kinase 1 (S6K1) inhibitors can be prepared with possible therapeutic applications.
25311616 Data show that the induction of resveratrol-dependent autophagy is mediated via the mechanistic target of Akt proto-oncogene protein/rapamycin complex 1 (mTORC1)/S6 kinase 1 (S6K1) signaling pathway.
25220053 S6K1 enhances c-Myc translation efficiency by modulating the phosphorylation of eukaryotic initiation factor eIF4B, which is critical to unwind its structured 5' untranslated region.
25165983 Results show that high expression of p70S6K and 4EBP1 proteins may act as valuable independent biomarkers to predict poor prognosis of nasopharyngeal carcinoma patients.
25134527 Results demonstrate that the impact of S6K1 kinase on neuroblastoma cells is not mediated through modulation of GLI1 expression an the effects of S6K1 and GLI1 signaling on neuroblastoma cell proliferation are mediated through independent mechanisms.
25118997 The increased level of S6K1 is positively associated with obesity, insulin resistance and inflammation.
25061101 This study provides the first evidence for mTORC1/p70S6K-dependent regulation of pyrimidine biosynthesis in a relevant disease setting.
24936148 our results demonstrate that activation of the PI3K/Akt/mTOR/p70S6K signaling pathway is involved in S100A4-induced viability, migration, upregulation of VEGF and downregulation of E-cadherin in CRC cells.
24901052 Rapamycin-enhanced mitomycin C-induced apoptotic death is mediated through the S6K1-Bad-Bak pathway in peritoneal carcinomatosis.
24887566 Further experiments demonstrated that phosphatidylinositide 3-kinases/protein kinase B/mammalian target of rapamycin/p70S6 kinase (PI3K/AKT/mTOR/p70S6K) and extracellular regulated protein kinases (ERK).
24875531 Our data suggest that RP loss promotes the aberrant activation of both S6 kinase and p53 by increasing intracellular ROS levels
24860943 These results demonstrate that S6K1 and arginase-II form a positive circuit mediating the detrimental effects of chronic L-arginine supplementation on endothelial cells.
24859886 Data indicate that zinc finger protein SNAIL modulates ribosomal protein S6 kinase 1 (RPS6KB1)/HIF-1alpha/protein kinase 2 (PKM2) signaling pathway through miR-128.
24729449 S6 kinase inhibition leads to suppression of prostate cancer cell growth and sensitization to paclitaxel.
24675012 These studies demonstrated that fisetin inhibits mTOR and p70S6K through direct binding while the observed inhibitory effect of fisetin on AKT is mediated indirectly, through targeting interrelated pathways.
24661902 p70S6K activity positively contributes to proliferation and invasion of breast cancer cell lines.
24652283 The acetylation of the CTR of S6K1 is inhibited by the class III histone deacetylases, SIRT1 and SIRT2.
24648513 Data indicate that Rheb G63A stimulated phosphorylation of the mTORC1 substrate p70S6 kinase more strongly than wild-type, thus offering a new tool for mammalian target of rapamycin (mTOR) signaling.
24606695 Blocking PI3K, mTORC2 or p70S6K activity prevents lethal autophagy and decreases infectious virus production.
24582588 In cells expressing the VPS34-Y231F mutant, which blocks lamellipodia formation, mTOR localization at the plasma membrane and insulin-mediated S6K1 activation are reduced.
24501087 our data emphasizes the importance of the translational regulation of p21 by the MEK1/2-ERK1/2-p70S6K pathway to negatively control the cell cycle progression.
24469069 CXCL4 and CXCL4L1 activated p38 MAPK, as well as Src kinase within 30 and 5 min, respectively. Extracellular signal-regulated kinase (ERK) phosphorylation occurred in activated lymphocytes.
24456794 Data indicate that p70 S6 inhibitor LY2584702 was not well tolerated when administered with erlotinib.
24447434 Patients whose tumor expresses Phosphorylated p70S6K, as a marker of downstream Phosphatidylinositol 3-Kinase and/or Mitogen-Activated Protein Kinase pathway activation, have a favorable prognosis, but do not benefit from adjuvant tamoxifen.
24440085 Data indicate that p70 S6 kinase inhibitor LY2584702 treatment was not dose proportional with increasing dose.
24337579 PKD3 in TNBC cells provides a molecular connection between the Golgi and endolysosomal compartments to enhance proliferative mTORC1-S6K1 signaling.
24332215 Data suggest that the ribosomal S6 kinase : protein kinase B (AKT) phosphorylation ratio could be useful as a biomarker of target inhibition by RAD001.
24287118 Ghrelin stimulated the rapid phosphorylation of mammalian target of rapamycin (mTOR), P70S6K and S6.
24280132 Estradiol enhances CIP2A expression by the activation of p70 S6 kinase.
24277938 Data indicate that ribosomal S6 kinase 1 (S6K1) is negatively involved in the toll-like receptorS TLR2 and TLR4 signaling pathway by the inhibition of TAK1 (MAP3K7) activity.
24239466 Data indicate that the combined activity of pS6K and elf4E regulates cell proliferatioin, cell migration and invasion in bladder cancer cells.
24157791 this study suggests that miR-145 modulates ovarian cancer growth and invasion by suppressing p70S6K1 and MUC1, functioning as a tumor suppressor.
24089522 impaired phosphorylation and ubiquitination by p70S6K and Smurf1 increase the protein stability of TRIB2 in liver cancer
24067973 Constitutive mTOR signaling induces the formation of giant cells via phosphorylation of S6K.
24058693 H2O2 stimulated phosphorylation of RSK and MSK kinases at residues that are homologous to Thr389 in S6K1. This phosphorylation required the activity of either p38 or ERK MAP kinases.
24030155 overexpression of 4EBP1, p70S6K, Akt1 or Akt2 could promote the Coxsackievirus B3-induced apoptosis.
24023352 expression of p-S6K1 may be a predictive marker of resistance to neoadjuvant chemotherapy in patients with breast cancer
23938603 Vascular tumors (both angiosarcomas and capillary infantile hemangiomas) exhibit increased activation of p70-S6K; knockdown of p70-S6K results in reduced tumor cell proliferation and migration.
23886172 High phosphorylated RPS6KB1 expression is associated with non- small cell lung cancer.
23739915 There is an increased genetic risk for multiple sclerosis with the rs180515 single nucleotide polymorphism in RPS6KB1.
23731517 Phosphorylation of the hydrophobic motif in S6K1 is independent of, and probably precedes and promotes, phosphorylation of the activation loop.
23639457 The AKT/S6K signaling pathway participates in atrial fibrillation and rheumatic mitral valve disease.
23632629 Muscle biopsies were collected before and 1 and 3 h post resistance exercise and phosphorylation of mTOR (Ser(2)) increased 2-fold (P < 0.05) and that of S6K1 (Thr(3)) 14-fold (P < 0.05).
23393338 No amplification of S6K1 was detected in gastric cancer tissues
23376066 These findings collectively suggest that S6K1 plays an important role in tumor cell survival under stress conditions, and thus inhibition of S6K1 may be an effective strategy for sensitizing cells to glucose deprivation.
23330000 HIV+/EBV+ aggressive diffuse large B-cell lymphoma could be potentially treated by targeting RPS6KB1 and CDC2 genes.
23276696 HMGA2 overexpression induced a PI3K/Akt/mTOR/p70S6K cascade, which in turn suppressed the expression of p16(INK4A) and p21(CIP1/WAF1) in human umbilical cord blood-derived stromal cells.
23273915 alternative splicing of S6K1 acts as a molecular switch in breast cancer cells, elevating oncogenic isoforms that activate mTORC1.
23044732 The p70S6K1 total protein content of quadriceps muscle increased after concurrent strength and interval training.
22977662 The nuclear expression of p-mTOR, p-4E-BP1 and p-p70S6K was associated with biological behaviors (invasiveness) of ameloblastomas, and p-mTOR was an independent predictor of them.
22871496 High RPS6KB1 expression is associated with ovarian granulosa cell tumor.
22795649 suppression of Jurkat cell proliferation by C. pneumoniae was at least in part mediated by down modulation of protein synthesis through attenuation of Thr389 phosphorylation of p70S6K.
22705322 in human adipose tissue phosphorylated Threonine in S6K1 is a marker for increased glucose levels
22684641 Our data suggest that RPS6KB1 may play an important role in the progression of hepatocellular carcinoma
22574368 Rapamycin can effectively suppress the proliferation of prostate cancer 22RV1 cells by regulating the expression of S6K1.
22457523 Together, these observations suggested that hepatitis C virus infection activates the mTOR/S6K1 pathway in inhibiting IRS-1 function and perturbs glucose metabolism via downregulation of GLUT4 and upregulation of PCK2 for insulin resistance.
22442669 the role and mechanism of miR-128 in regulating glioma tumor angiogenesis via miR-128/p70S6K1 axis
22439934 An activated mTOR/S6K1 pathway promotes Gli1 transcriptional activity and oncogenic function through S6K1-mediated Gli1 phosphorylation at Ser84, which releases Gli1 from its endogenous inhibitor, SuFu.
22391570 Fatty-acid oxidation in response to S6K1 inactivation.
22348058 the effect of TBC1D3 on IRS-1:S636/639 phosphorylation is mediated through TBC1D3-induced activation of protein phosphatase 2A (PP2A), followed by suppression of T389 phosphorylation on p70 S6 kinase
22286763 S6K1 directly phosphorylates and regulates ligand-independent activity of ERalpha, while ERalpha upregulates S6K1 expression.
22248270 High p70S6K phosphorylation is associated with intrahepatic cholangiocarcinoma.
22110663 S6K1 and 4E-BP1 are independent regulated and control cellular growth in bladder cancer
21986499 Knockdown of PHLPP1 or PHLPP2 resulted in an increase in S6K1 phosphorylation.
21757621 S6K1 and mTOR regulate Rac1-driven platelet activation and aggregation.
21710263 Proper nucleocytoplasmic localization of p70 S6K1 depends on its mTOR-mediated phosphorylation but not on its kinase activity.
21609291 Acute manipulation of eccentric exercise velocity does not seem to differently influence intracellular hypertrophy signaling through the Akt/mTORCI/p70S6K pathway.
21561857 phosphorylation of S6K1 is required for mTOR to phosphorylate the hydrophobic motif of S6K1.
21541441 Data show that the deregulated kinase activities identified, which include the mTOR/p70S6K and ERK1/2 pathways, are potential novel molecular targets in MM.
21536668 nSMase2 is a major component of ATRA-induced growth arrest of MCF-7 cells; S6K is a novel downstream target of nSMase2
21467264 A fusion transcript (RPS6KB1-VMP1) recurrently expressed in 30% of breast cancers is associated with clinical consequences and may indicate genomic instability altering the expression of oncogenic components such as MIR21 and RPS6KB1.
21444676 S6K2 expression dictates tissue-specific requirement for S6K1 in mediating aberrant mTORC1 signaling and tumorigenesis
21440577 Studies indicate that the inhibition of mTORC1 by FOXO could lead to the activation of Akt via the inhibition of the negative feedback loop driven by mTORC1 and S6K1.
21424608 The observations may have practical implications as they raise the possibility to consider p70S6K and/or S6 as a potential therapeutic target-besides mTOR-in certain lymphomas and perhaps in clinical immunosuppression.
21390332 Knockdown of SIRT1 abolished GR-induced p16 repression as well as Akt/p70S6K1 activation implying that SIRT1 may affect p16 repression through direct deacetylation effects and indirect regulation of Akt/p70S6K1 signaling.
21297943 Akt2 specifically targets and activates the p70S6K signaling pathway
21292829 Findings support a novel link between the IGF pathway and ERalpha, in which the translation factor S6K1 affects transcription of ERalpha-regulated genes.
21289241 gestational diabetes mellitus and impaired glucose tolerance subjects had a persistent activation and increased S6K1 phosphorylation compared to subjects with normal glucose tolerance
21258406 Results reveal a new direction for understanding the oncogenic roles of p70(S6K) in tumor progression.
21228102 GSK3beta inactivation in podocytes results in decreased phosphorylation of p70S6K accompanied by cytoskeletal rearrangements and inhibited motility.
21224254 Disruption of adaptive energy metabolism and increased levels of p-S6K1 are contributing factors in infantile neuronal ceroid lipofuscinosis pathogenesis.
21184268 Phosphorylated S6K1 is associated with endocrine therapy resistance in hormone receptor-positive breast cancer.
21093473 Results suggest that S6-kinases 1 and 2 are dispensable for the induction of SREBP processing.
21067588 Data show that the mTOR effectors, 4EBP1, p70S6K and rpS6, are highly activated in cultured and primary FLT3-mutated acute myeloid leukemia (AML) cells.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
21035469 Data show that genetic variation in RPS6KA1, RPS6KA2, and PRS6KB2 were associated with risk of developing colon cancer while only genetic variation in RPS6KA2 was associated with altering risk of rectal cancer.
21035469 Observational study of gene-disease association. (HuGE Navigator)
20961652 Erk1/2 MAPK and PI3K/Akt signalling triggers invasion through distinct downstream effectors involving mTOR/p70S6K and Rac1 activation.
20953835 S6K1 and S6K2 gene amplification was associated with a worse prognosis.
20932932 Dysregulation of S6 kinases contributes to the pathogenesis of human diseases.
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20731018 Data indicate that high ErbB2 expression enhances cholangiocarcinoma invasion, motility and proliferation via the AKT/p70S6K pathway.
20657550 By searching for the kinases responsible for Mdm2 S163 phosphorylation under genotoxic stress, the authors identified S6K1 as a multifaceted regulator of Mdm2.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20617335 when exercise is performed in a fasted state, the increase in phosphorylation of signalling molecules such as p70(S6k) and the S6 ribosomal protein in human muscle depends on the exercise volume
20599721 K516 acetylation may serve to modulate important kinase-independent functions of S6K1 in response to growth factor signalling.
20599538 p70S6K1 is required for tumor growth and angiogenesis through HIF-1alpha and VEGF expression, providing a molecular mechanism of human ovarian cancer mediated by p70S6K1 signaling.
20459645 blocking of OPN-induced ICAM-1 expression through mTOR/p70S6 kinase signaling pathway may be an important therapeutic strategy for the treatment of breast cancer.
20433920 HIV-1 Tat-peptide(48-60) inhibits AGC-family kinases (PKB, SGK1, S6K1, MSK1), CAMK-family kinases (CAMK1 and MELK) and a STE family kinase (MKK1)
20423989 p70S6K plays an important role in metastasis by regulating key proteins which are essential for cell attachment, survival, invasion, and metastasis in breast cancer.
20410302 IL-8 reverses an mTOR/S6K-led down-regulation of PLD2 expression and enables PLD2 to fully function as a facilitator for cell migration
20374740 S6K is primarily involved in regulation of cell size, and affects glucose homeostasis, but is dispensable for global protein synthesis, whereas translational efficiency of TOP mRNAs is a determinant of the cellular protein synthesis capacity.
20190034 BMP-4, TGF-beta1, 5-HT, and ET-1 treatment induced phosphorylation of p70S6K and ribosomal protein S6, and siRNAs against p70S6K and S6 blocked pulmonary artery hypertrophic response.
20187284 p70s6k phosphorylation is increased during intake of a protein-carbohydrate drink following resistance exercise in the fasted state.
20173664 Characterizing the expression of PTEN, AKT and pS6 Ser235/236 might be a useful predictive tool for deciding whether to use mTOR inhibitors to treat conjunctiva melanomas.
20157535 These data indicate that S6K1 is important for the full induction of autophagy in mammals and raise the possibility that some of the beneficial effects of resveratrol are due to modulation of S6K1 activity.
20137651 P(70)S6K activity increased with the increase in the birth weight of the fetus. Insulin can regulate the activities of P(70)S6K in the placenta and earlier nutrient cells.
19995915 found that Rictor phosphorylation requires mTOR complex 1 activity and, more specifically, the p70 ribosomal S6 kinase 1 (S6K1).
19936974 High p70S6K is associated with osteosarcoma progression.
19914247 The results reveal an opposing and uncoupling effect of mTOR and S6K1 in regulating TF expression.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19889638 Oscillatory shear stress induces osteoblast-like cell proliferation through activation of alpha(v)beta(3) and beta(1) integrins and synergistic interactions of FAK and Shc with PI3K, leading to the modulation of ERK and Akt/mTOR/p70S6K pathways.
19881535 We provide evidence for a previously unrecognized phospholipase C-gamma1 (PLC-gamma1)-controlled mechanism of mTOR/p70S6-kinase activation
19864428 Data report the crystal structures of the kinase domain of p70S6K1 bound to staurosporine in both the unphosphorylated state and in the 3'-phosphoinositide-dependent kinase-1-phosphorylated state in which Thr-252 of the activation loop is phosphorylated.
19815051 Data show that everolimus/RAD001 significantly inhibits cell viability in a dose- and time-dependent fashion, and diminishes phosphorylation of Akt downstream targets, mTOR and p70S6K, in human medullary thyroid carcinoma cells.
19801633 Data show that B[a]PDE increases cyclin D1 expression, and activate the PI3-kinase/Akt/MAPK- and p70s6k pathway in Beas-2B bronchial epithelial cells.
19730801 Tyrosine kinase receptors and G protein-coupled receptors trigger distinct p70S6K active conformations.
19285034 SCF can cause a MEK1-independent but PI3K-dependent activation of MAPK, and also MEK1-dependent activation of p70 S6 kinase in ovarian cancer cells.
19266162 S6K1 plays an important role in the regulation of insulin action on glucose metabolism in skeletal muscle.
19240722 a negative correlation (R=-0.73, P<0.0001) between the RPS6 and the VEGFR2 gene, which is consistent as the gene expression and phosphorylation of S6 is inversely regulated.
19112174 RPS6KB1 regulates estrogen receptor alpha (ERalpha) by phosphorylating it on serine 167, leading to transcriptional activation of ERalpha.
19085255 Activation, regulation, and function of S6K1 isoforms was determined in breast cancer.
19065636 These data suggest that the S6K1/4E-BP1 pathway may play an important role in polyploidization of megakaryocytes.
18952604 S6K1 directly phosphorylates IRS-1 on Ser-270 to promote insulin resistance in response to TNF-(alpha) signaling through IKK2.
18829578 The role and molecular mechanism of p70S6K1 in regulating angiogenesis and tumor growth, and angiogenesis.
18813808 activation of the Akt-mTOR-p70S6K pathway plays a significant role in HCC progression by promoting neoangiogenesis.
18660489 Observational study of gene-disease association. (HuGE Navigator)
18652687 Gene silencing of p70S6K by siRNA alters gene expression in two breast cancer cell lines.
18565837 Resistance exercise decreases eIF2Bepsilon phosphorylation and potentiates the feeding-induced stimulation of p70S6K1 and rpS6 in young men.
18461003 p70 S6K Thr 389 (ribosomal protein S6 kinase 70kDa polypeptide 1) phosphorylation was attenuated during resistance exercise
18423201 SKAR-mediated recruitment of activated S6K1 to newly processed mRNPs serves as a conduit between mTOR checkpoint signaling and the pioneer round of translation when cells exist in conditions supportive of protein synthesis.
18025271 Cyclin G2 expression is modulated by HER2 signaling through multiple pathways including phosphoinositide 3-kinase, c-jun NH(2)-terminal kinase, and mTOR signaling.
17936702 Data show that URI and PP1gamma are components of an S6K1-regulated mitochondrial pathway dedicated to oppose sustained S6K1 survival signaling and to ensure that the threshold for apoptosis is set based on nutrient and growth factor availability.
17908691 Rapamycin inhibits S6K1-dependent IRS-1 serine phosphorylation, increases IRS-1 protein levels, and promotes association of tyrosine-phosphorylated IRS-1 with PI3K.
17622239 HPV16 modifies S6 kinase activation via mechanism, which activates S6 kinase downstream of Akt function.
17616691 AKT amplification and the mTOR/p70S6K1 pathway play an important role in human lung cancer cells acquiring CDDP resistance
17604271 PRAS40 acts downstream of mTORC1 but upstream of its effectors, such as S6K1 and 4E-BP1
17599906 The inhibition of Akt and S6K1 phosphorylation by PRR5 knock down correlates with reduction in the expression level of platelet-derived growth factor receptor beta (PDGFRbeta).
17569770 phosphorylation increased following low-intensity resistance exercise training combined with blood flow restriction
17427199 ERK cascade regulates motility of hepatocellular carcinoma cells via uPAR production and p70S6K phosphorylation.
17336708 Monitoring P70(S6K) phosphorylation can help predict and monitor the biological effectiveness of rapamycin in renal transplant recipients with Kaposi sarcoma.
17255101 p70 S6 kinase activates PAK1 and contributes to phosphatidylinositol 3-kinase- and ERK-mediated regulation of HCV RNA replication
17053147 in response to mitogens, PDCD4 was rapidly phosphorylated by protein kinase S6K1 & then degraded by ubiquitin ligase SCF(betaTRCP); it is proposed that regulated degradation of PDCD4 in response to mitogens allows efficient protein synthesis & cell growth
17052453 S6K1 regulates GSK3 under conditions of mTOR-dependent feedback inhibition of Akt
17045920 This study demonstrates a novel mechanism of EGF-induced VEGF and HIF-1alpha expression through production of H2O2 and activation of AKT and p70S6K1 in human ovarian cancer cells.
16962100 Collectively, these data suggested that acetaldehyde did not adversely affect glucose uptake despite inhibition of insulin signaling cascade at the levels of Akt and mTOR, possibly due to enhanced p70(S6K) phosphorylation.
16914728 These studies suggest that, through serine phosphorylation, Raptor-mTOR and S6K1 promote the depletion of IRS1 from specific intracellular pools in pathological states of insulin and IGF-I resistance and in lesions associated with tuberous sclerosis.
16883576 These results suggest that p70S6K1 regulates turnover of HDM2 protein for cancer development.
16839745 Inhibition of p70S6K1 activity by its siRNA also decreased cell migration, invasion, and proliferation associated with the induction of p27(KIP1) levels, and with the inhibition of cell cycle-associated proteins.
16826166 In the presence of urokinase plasminogen activator, overexpression of ganglioside GM3 paradoxically increases proliferation of carcinoma cells by augmenting ERK-independent p70S6 kinase activation.
16818690 The higher expressions of p-p70S6K was associated with worse outcome in glioblastoma.
16715128 both S6K1 and eukaryotic translation initiation factor 4E binding protein 1 pathways, regulated by TORC1, are required for cell motility
16469801 p70S6K activation induces expression of MMP-9 associated with hepatocyte growth factor-mediated invasion in human ovarian cancer cells
16434552 We conclude that resistance exercise effectively increases the phosphorylation of S6K1 on Thr421/Ser424, which is not associated with a substantial increase in S6 phosphorylation in a fasted state.
16407298 mTOR nuclear import is required for its cytoplasmic signaling to S6K1
16286006 S6K1 maneuvers on and off the eukaryotic initiation factor 3 translation initiation complex.
16262259 These data suggest that PI3K-dependent T389/T229 phosphorylation is limiting in late-phase p70S6K activation by EGF and contributes to the cooperative effect of GPCRs on p70S6K activity and cell growth.
16049009 hVps34 is a nutrient-regulated lipid kinase that integrates amino acid and glucose inputs to mTOR and S6K1
15953364 The mainly anti-apoptotic p70S6k signalling is downregulated in cellular and transgenic models of Alzheimer's disease and in peripheral cells of patients, and could contribute to the pathogenesis of the disease.
15899889 p70S6 kinase is a major effector of mTOR phosphorylation at Ser-2448 in response to both mitogen- and nutrient-derived stimuli
15812314 Although zinc could induce cell proliferation and cell growth, and increased phosphorylation of neurofilaments, only cell growth appeared to be related to p7056kinase activation.
15790787 interferon alpha has a role in regulating the p70 S6 kinase pathway in chronic myelogenous leukemia cells
15723049 S6 kinase 1 is essential for the control of muscle cytoplasmic volume by Akt and mTOR
15696579 identified p70 S6 kinase as a major signal transduction pathway activated by OPN-1 during the migratory response in JAR cells
15692808 Ability of hyperinsulinaemia to increase mTOR/p70 S6K pathway activity and IRS-1/2 serine phosphorylation in a tissue-specific fashion.
15659381 RSPRR motif interacts with a negative regulator of S6K1 that is normally suppressed by mTOR.
15623621 Overexpression of ribosomal protein S6 kinase, 70kDa is associated with liver neoplasms
15533996 REVIEW: negative feedback of the PI3K-Akt pathway; one feedback loop composed of mTOR and ribosomal S6 kinase blocks further activation of the pathway through inhibition of insulin receptor substrate function
15474452 VEGF and HIF-1alpha expression are inhibited by SU5416 through the inhibition of PI3K/AKT/p70S6K1 pathway in ovarian cancer cells
15319361 the response of muscle protein synthesis to insulin and amino acid is impaired in elderly humans; a defect in S6K1 pathway activation may be responsible for this alteration
15304500 autocrine TGFalpha regulates cell adhesion function by multiple signaling pathways via specific phosphorylation sites of S6K in cancer cells
15203190 Akt and P70S6K phosphorylation and Gadd45 levels are modulated by GPx-1 in tumor cells
15158097 the increase in basal phosphorylation of p70S6K upon granulocytic differentiation of myeloid leukemic cells and their responses to GM-CSF that are closely paralleled with tyrosyl phosphorylation of its receptor
15028555 PI3K mediates G(1) progression and cyclin expression through activation of an AKT/mTOR/p70S6K1 signaling pathway in the ovarian cancer cells.
12869548 transient expression of the wild type Rheb1 or Rheb2 causes activation of p70S6K, while expression of Rheb1D60K mutant results in inhibition of basal level activity of p70S6K
12801526 TNF-receptor activation leads to activation of the p70S6K; TRAF4 is a mediator in this TNF-induced signaling pathway; and TRAF4 inhibits Fas-induced apoptosis
12747804 Muscarinic receptors mediate activation of this enzymme in astrocytoma cells, coupled with pi 3-kinase activation.
12733712 both p70S6K and Akt are activated in the majority of human papillary cancer cells
12586835 Cdc2 provides a signal that triggers inactivation of S6K1 in mitosis.
12019261 TF cytoplasmic domain-independent stimulation of protein synthesis via activation of S6 kinase contributes to FVIIa effects in pathophysiology.
10807185 HIV-1 Tat-peptide(48-60) inhibits AGC-family kinases (PKB, SGK1, S6K1, MSK1), CAMK-family kinases (CAMK1 and MELK) and a STE family kinase (MKK1)
10089566 HIV-1 Tat-peptide(48-60) inhibits AGC-family kinases (PKB, SGK1, S6K1, MSK1), CAMK-family kinases (CAMK1 and MELK) and a STE family kinase (MKK1)

AA Sequence

MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVGPYELGMEHCE      1 - 70
KFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIFAMKVLKKAMIVRNAKDTAHT     71 - 140
KAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLH    141 - 210
QKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLG    211 - 280
ALMYDMLTGAPPFTGENRKKTIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHP    281 - 350
FFRHINWEELLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLE    351 - 420
SVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSGIEQMDVTMSG    421 - 490
EASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL                                       491 - 525
//

Text Mined References (263)

PMID Year Title
26818518 2016 Rho Kinase Inhibition as a Therapeutic for Progressive Supranuclear Palsy and Corticobasal Degeneration.
26626074 2016 Silencing of angiotensin II type-1 receptor inhibits high glucose-induced epithelial-mesenchymal transition in human renal proximal tubular epithelial cells via inactivation of mTOR/p70S6K signaling pathway.
26514620 2016 p(??S?K¹) in the TORC1 pathway is essential for the differentiation of Th17 Cells, but not Th1, Th2, or Treg cells in mice.
26506538 2016 Microcystin-LR promotes proliferation by activating Akt/S6K1 pathway and disordering apoptosis and cell cycle associated proteins phosphorylation in HL7702 cells.
26496226 2015 Immediate-early response 5 (IER5) interacts with protein phosphatase 2A and regulates the phosphorylation of ribosomal protein S6 kinase and heat shock factor 1.
26468204 2015 Reducing Ribosomal Protein S6 Kinase 1 Expression Improves Spatial Memory and Synaptic Plasticity in a Mouse Model of Alzheimer's Disease.
26427479 2016 The mTOR Kinase Inhibitor INK128 Blunts Migration of Cultured Retinal Pigment Epithelial Cells.
26362858 2015 Rapamycin restores p14, p15 and p57 expression and inhibits the mTOR/p70S6K pathway in acute lymphoblastic leukemia cells.
26238185 2015 MiR-497 decreases cisplatin resistance in ovarian cancer cells by targeting mTOR/P70S6K1.
26235873 2015 Inactivated Sendai virus induces apoptosis and autophagy via the PI3K/Akt/mTOR/p70S6K pathway in human non-small cell lung cancer cells.
26172298 2015 eIF3 controls cell size independently of S6K1-activity.
26169935 2015 Leucine does not affect mechanistic target of rapamycin complex 1 assembly but is required for maximal ribosomal protein s6 kinase 1 activity in human skeletal muscle following resistance exercise.
26080838 2015 miR-195 Inhibits Tumor Progression by Targeting RPS6KB1 in Human Prostate Cancer.
25846498 2015 Role of hepatocyte S6K1 in palmitic acid-induced endoplasmic reticulum stress, lipotoxicity, insulin resistance and in oleic acid-induced protection.
25784113 2015 Clinically significant association between the maximum standardized uptake value on 18F-FDG PET and expression of phosphorylated Akt and S6 kinase for prediction of the biological characteristics of renal cell cancer.
25762619 2015 Both mTORC1 and mTORC2 are involved in the regulation of cell adhesion.
25659153 2015 Tanshinone IIA inhibits HIF-1? and VEGF expression in breast cancer cells via mTOR/p70S6K/RPS6/4E-BP1 signaling pathway.
25635535 2015 Role of p38 mitogen-activated protein kinase in vascular endothelial aging: interaction with Arginase-II and S6K1 signaling pathway.
25600244 2015 Activation of mTOR/S6K But Not MAPK Pathways Might Be Associated With High Ki-67, ER(+), and HER2(-) Breast Cancer.
25379021 2014 Resistance to Selumetinib (AZD6244) in colorectal cancer cell lines is mediated by p70S6K and RPS6 activation.
25356520 2015 Development of organometallic S6K1 inhibitors.
25311616 2014 Phosphoproteomics reveals resveratrol-dependent inhibition of Akt/mTORC1/S6K1 signaling.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25220053 2014 The mTORC1/S6K1 pathway regulates glutamine metabolism through the eIF4B-dependent control of c-Myc translation.
25165983 2014 Activation of Akt/mTOR pathway is associated with poor prognosis of nasopharyngeal carcinoma.
25134527 2014 The impact of S6K1 kinase on neuroblastoma cell proliferation is independent of GLI1 signaling.
25118997 2015 Expression of S6K1 in human visceral adipose tissue is upregulated in obesity and related to insulin resistance and inflammation.
25061101 2014 Targeting mTORC1-mediated metabolic addiction overcomes fludarabine resistance in malignant B cells.
24936148 2014 Activation of the PI3K/Akt/mTOR/p70S6K pathway is involved in S100A4-induced viability and migration in colorectal cancer cells.
24901052 2014 Rapamycin-enhanced mitomycin C-induced apoptotic death is mediated through the S6K1-Bad-Bak pathway in peritoneal carcinomatosis.
24887566 2014 Mollugin induces tumor cell apoptosis and autophagy via the PI3K/AKT/mTOR/p70S6K and ERK signaling pathways.
24875531 2014 Ribosomal protein mutations induce autophagy through S6 kinase inhibition of the insulin pathway.
24860943 2014 Long term exposure to L-arginine accelerates endothelial cell senescence through arginase-II and S6K1 signaling.
24859886 2014 Loss of SNAIL inhibits cellular growth and metabolism through the miR-128-mediated RPS6KB1/HIF-1?/PKM2 signaling pathway in prostate cancer cells.
24729449 2014 Targeting ribosomal S6 kinases/Y-box binding protein-1 signaling improves cellular sensitivity to taxane in prostate cancer.
24675012 2014 Fisetin inhibits human melanoma cell growth through direct binding to p70S6K and mTOR: findings from 3-D melanoma skin equivalents and computational modeling.
24661902 2014 p70S6 kinase mediates breast cancer cell survival in response to surgical wound fluid stimulation.
24652283 2014 Cross-talk between sirtuin and mammalian target of rapamycin complex 1 (mTORC1) signaling in the regulation of S6 kinase 1 (S6K1) phosphorylation.
24648513 2014 Structure-guided mutation of the conserved G3-box glycine in Rheb generates a constitutively activated regulator of mammalian target of rapamycin (mTOR).
24606695 2014 mTOR/p70S6K signaling distinguishes routine, maintenance-level autophagy from autophagic cell death during influenza A infection.
24582588 2014 Insulin activation of vacuolar protein sorting 34 mediates localized phosphatidylinositol 3-phosphate production at lamellipodia and activation of mTOR/S6K1.
24501087 2014 MEK1/2 overactivation can promote growth arrest by mediating ERK1/2-dependent phosphorylation of p70S6K.
24469069 2014 CXCL4L1 and CXCL4 signaling in human lymphatic and microvascular endothelial cells and activated lymphocytes: involvement of mitogen-activated protein (MAP) kinases, Src and p70S6 kinase.
24456794 2014 A phase Ib trial of LY2584702 tosylate, a p70 S6 inhibitor, in combination with erlotinib or everolimus in patients with solid tumours.
24447434 2014 Phosphorylated p-70S6K predicts tamoxifen resistance in postmenopausal breast cancer patients randomized between adjuvant tamoxifen versus no systemic treatment.
24440085 2014 A phase I trial of LY2584702 tosylate, a p70 S6 kinase inhibitor, in patients with advanced solid tumours.
24337579 2014 Elevated protein kinase D3 (PKD3) expression supports proliferation of triple-negative breast cancer cells and contributes to mTORC1-S6K1 pathway activation.
24332215 2014 Ribosomal S6 kinase and AKT phosphorylation as pharmacodynamic biomarkers in patients with myelodysplastic syndrome treated with RAD001.
24287118 2014 Ghrelin protects human umbilical vein endothelial cells against high glucose-induced apoptosis via mTOR/P70S6K signaling pathway.
24280132 2014 Estradiol enhances CIP2A expression by the activation of p70 S6 kinase.
24277938 2014 S6K1 negatively regulates TAK1 activity in the toll-like receptor signaling pathway.
24239466 2014 Dual inhibition by S6K1 and Elf4E is essential for controlling cellular growth and invasion in bladder cancer.
24157791 2013 MiR-145 is downregulated in human ovarian cancer and modulates cell growth and invasion by targeting p70S6K1 and MUC1.
24089522 2013 Impaired phosphorylation and ubiquitination by p70 S6 kinase (p70S6K) and Smad ubiquitination regulatory factor 1 (Smurf1) promote tribbles homolog 2 (TRIB2) stability and carcinogenic property in liver cancer.
24067973 2013 Hypoxia induces permeability and giant cell responses of Andes virus-infected pulmonary endothelial cells by activating the mTOR-S6K signaling pathway.
24058693 2013 Contribution of S6K1/MAPK signaling pathways in the response to oxidative stress: activation of RSK and MSK by hydrogen peroxide.
24030155 2013 Overexpression of 4EBP1, p70S6K, Akt1 or Akt2 differentially promotes Coxsackievirus B3-induced apoptosis in HeLa cells.
24023352 2013 Phosphorylated S6 kinase-1: a breast cancer marker predicting resistance to neoadjuvant chemotherapy.
23938603 2013 Vascular tumors have increased p70 S6-kinase activation and are inhibited by topical rapamycin.
23886172 2013 Prognostic value of phosphorylated mTOR/RPS6KB1 in non- small cell lung cancer.
23739915 2013 MANBA, CXCR5, SOX8, RPS6KB1 and ZBTB46 are genetic risk loci for multiple sclerosis.
23731517 2013 Crystal structures of S6K1 provide insights into the regulation mechanism of S6K1 by the hydrophobic motif.
23639457 2013 Focal adhesion kinase mediates atrial fibrosis via the AKT/S6K signaling pathway in chronic atrial fibrillation patients with rheumatic mitral valve disease.
23632629 2013 Resistance exercise induced mTORC1 signaling is not impaired by subsequent endurance exercise in human skeletal muscle.
23429703 2013 Stimulation of de novo pyrimidine synthesis by growth signaling through mTOR and S6K1.
23393338 2013 Gene amplification of ribosomal protein S6 kinase-1 and -2 in gastric cancer.
23376066 2013 Inhibition of S6K1 enhances glucose deprivation-induced cell death via downregulation of anti-apoptotic proteins in MCF-7 breast cancer cells.
23330000 2013 Amplified RPS6KB1 and CDC2 genes are potential biomarkers for aggressive HIV+/EBV+ diffuse large B-cell lymphomas.
23276696 2013 HMGA2 regulates the in vitro aging and proliferation of human umbilical cord blood-derived stromal cells through the mTOR/p70S6K signaling pathway.
23273915 2013 S6K1 alternative splicing modulates its oncogenic activity and regulates mTORC1.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23044732 2013 Molecular adaptations to concurrent training.
22977662 2012 Expression of phosphorylated mTOR and its regulatory protein is related to biological behaviors of ameloblastoma.
22871496 2012 Pharmacological targeting of mammalian target of rapamycin inhibits ovarian granulosa cell tumor growth.
22797923 2012 ZNRF2 is released from membranes by growth factors and, together with ZNRF1, regulates the Na+/K+ATPase.
22795649 2013 Jurkat cell proliferation is suppressed by Chlamydia (Chlamydophila) pneumoniae infection accompanied with attenuation of phosphorylation at Thr389 of host cellular p70S6K.
22705322 2013 Phosphorylated S6K1 (Thr389) is a molecular adipose tissue marker of altered glucose tolerance.
22684641 2012 Overexpression of RPS6KB1 predicts worse prognosis in primary HCC patients.
22574368 2012 [Rapamycin inhibits the proliferation of prostate cancer cell line 22RV1 and activity of S6K1].
22457523 2012 Hepatitis C virus activates the mTOR/S6K1 signaling pathway in inhibiting IRS-1 function for insulin resistance.
22442669 2012 MiR-128 inhibits tumor growth and angiogenesis by targeting p70S6K1.
22439934 2012 The crosstalk of mTOR/S6K1 and Hedgehog pathways.
22391570 2013 S6K1 determines the metabolic requirements for BCR-ABL survival.
22348058 2012 TBC1D3, a hominoid-specific gene, delays IRS-1 degradation and promotes insulin signaling by modulating p70 S6 kinase activity.
22286763 2012 Estrogenic regulation of S6K1 expression creates a positive regulatory loop in control of breast cancer cell proliferation.
22248270 2012 Immunohistochemical analysis of the mTOR pathway in intrahepatic cholangiocarcinoma.
22110663 2011 S6K1 and 4E-BP1 are independent regulated and control cellular growth in bladder cancer.
21986499 2011 PHLPP-mediated dephosphorylation of S6K1 inhibits protein translation and cell growth.
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
21757621 2011 S6K1 and mTOR regulate Rac1-driven platelet activation and aggregation.
21710263 2012 p70 S6K1 nuclear localization depends on its mTOR-mediated phosphorylation at T389, but not on its kinase activity towards S6.
21609291 2011 Effect of eccentric exercise velocity on akt/mtor/p70(s6k) signaling in human skeletal muscle.
21602892 2011 Nucleocytoplasmic localization of p70 S6K1, but not of its isoforms p85 and p31, is regulated by TSC2/mTOR.
21561857 2011 Hydrophobic motif phosphorylation is not required for activation loop phosphorylation of p70 ribosomal protein S6 kinase 1 (S6K1).
21541441 2011 Widespread deregulation of phosphorylation-based signaling pathways in multiple myeloma cells: opportunities for therapeutic intervention.
21536668 2011 Neutral sphingomyelinase-2 mediates growth arrest by retinoic acid through modulation of ribosomal S6 kinase.
21467264 2011 Transcriptional consequences of genomic structural aberrations in breast cancer.
21444676 2011 Differential expression of S6K2 dictates tissue-specific requirement for S6K1 in mediating aberrant mTORC1 signaling and tumorigenesis.
21440577 2011 Interplay between FOXO, TOR, and Akt.
21424608 2011 Mitotic lymphoma cells are characterized by high expression of phosphorylated ribosomal S6 protein.
21390332 2011 p16(INK4a) suppression by glucose restriction contributes to human cellular lifespan extension through SIRT1-mediated epigenetic and genetic mechanisms.
21297943 2011 Ablation of Akt2 induces autophagy through cell cycle arrest, the downregulation of p70S6K, and the deregulation of mitochondria in MDA-MB231 cells.
21292829 2011 The IGF pathway regulates ER? through a S6K1-dependent mechanism in breast cancer cells.
21289241 2011 Chronically increased S6K1 is associated with impaired IRS1 signaling in skeletal muscle of GDM women with impaired glucose tolerance postpartum.
21258406 2011 p70 S6 kinase in the control of actin cytoskeleton dynamics and directed migration of ovarian cancer cells.
21228102 2011 GSK3? inactivation in podocytes results in decreased phosphorylation of p70S6K accompanied by cytoskeletal rearrangements and inhibited motility.
21224254 2011 Disruption of adaptive energy metabolism and elevated ribosomal p-S6K1 levels contribute to INCL pathogenesis: partial rescue by resveratrol.
21184268 2011 Phosphorylated S6K1 is a possible marker for endocrine therapy resistance in hormone receptor-positive breast cancer.
21093473 2011 Genetic ablation of S6-kinase does not prevent processing of SREBP1.
21075311 2010 B55?-associated PP2A complex controls PDK1-directed myc signaling and modulates rapamycin sensitivity in colorectal cancer.
21067588 2010 mTOR signaling is activated by FLT3 kinase and promotes survival of FLT3-mutated acute myeloid leukemia cells.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
21035469 2011 Genetic variation in RPS6KA1, RPS6KA2, RPS6KB1, RPS6KB2, and PDK1 and risk of colon or rectal cancer.
20961652 p130Cas promotes invasiveness of three-dimensional ErbB2-transformed mammary acinar structures by enhanced activation of mTOR/p70S6K and Rac1.
20953835 2011 Clinical potential of the mTOR targets S6K1 and S6K2 in breast cancer.
20932932 2011 Functions and regulation of the 70kDa ribosomal S6 kinases.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20731018 2010 High expression of ErbB2 contributes to cholangiocarcinoma cell invasion and proliferation through AKT/p70S6K.
20657550 2010 S6K1 is a multifaceted regulator of Mdm2 that connects nutrient status and DNA damage response.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20617335 2010 The degree of p70 S6k and S6 phosphorylation in human skeletal muscle in response to resistance exercise depends on the training volume.
20599721 2010 S6K1 is acetylated at lysine 516 in response to growth factor stimulation.
20599538 2010 P70S6K 1 regulation of angiogenesis through VEGF and HIF-1alpha expression.
20459645 2010 Osteopontin selectively regulates p70S6K/mTOR phosphorylation leading to NF-kappaB dependent AP-1-mediated ICAM-1 expression in breast cancer cells.
20423989 2010 Targeting p70S6K prevented lung metastasis in a breast cancer xenograft model.
20410302 2010 Mammalian target of rapamycin (mTOR) and S6 kinase down-regulate phospholipase D2 basal expression and function.
20374740 2009 Ribosomal protein S6 kinase from TOP mRNAs to cell size.
20190034 2010 Pulmonary artery smooth muscle hypertrophy: roles of glycogen synthase kinase-3beta and p70 ribosomal S6 kinase.
20187284 2010 Increased p70s6k phosphorylation during intake of a protein-carbohydrate drink following resistance exercise in the fasted state.
20173664 2010 Evaluation of the mTOR pathway in ocular (uvea and conjunctiva) melanoma.
20157535 2009 Inhibition of mammalian S6 kinase by resveratrol suppresses autophagy.
20137651 2009 [The investigations on the relationship between the birth weight of fetus and the P70 S6K as well as mechanism insulin regulate the birth weight of fetus].
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19995915 2010 mTORC1-activated S6K1 phosphorylates Rictor on threonine 1135 and regulates mTORC2 signaling.
19936974 2010 mTOR/p70S6K signal transduction pathway contributes to osteosarcoma progression and patients' prognosis.
19935711 2010 Rictor is a novel target of p70 S6 kinase-1.
19914247 2010 Opposing and uncoupling effects of mTOR and S6K1 in the regulation of endothelial tissue factor expression.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19889638 2010 Oscillatory flow-induced proliferation of osteoblast-like cells is mediated by alphavbeta3 and beta1 integrins through synergistic interactions of focal adhesion kinase and Shc with phosphatidylinositol 3-kinase and the Akt/mTOR/p70S6K pathway.
19881535 2010 Novel pathway in Bcr-Abl signal transduction involves Akt-independent, PLC-gamma1-driven activation of mTOR/p70S6-kinase pathway.
19864428 2010 Structural basis of human p70 ribosomal S6 kinase-1 regulation by activation loop phosphorylation.
19815051 2010 The rapamycin-derivative RAD001 (everolimus) inhibits cell viability and interacts with the Akt-mTOR-p70S6K pathway in human medullary thyroid carcinoma cells.
19801633 2009 Cyclin D1 induction by benzo[a]pyrene-7,8-diol-9,10-epoxide via the phosphatidylinositol 3-kinase/Akt/MAPK- and p70s6k-dependent pathway promotes cell transformation and tumorigenesis.
19730801 2009 Developmental regulation of p70 S6 kinase by a G protein-coupled receptor dynamically modelized in primary cells.
19720745 2009 Characterization of Rictor phosphorylation sites reveals direct regulation of mTOR complex 2 by S6K1.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19570988 2009 Mechanism of PDK1-catalyzed Thr-229 phosphorylation of the S6K1 protein kinase.
19285034 2009 MEK1-independent activation of MAPK and MEK1-dependent activation of p70 S6 kinase by stem cell factor (SCF) in ovarian cancer cells.
19266162 2009 Post-transcriptional gene silencing of ribosomal protein S6 kinase 1 restores insulin action in leucine-treated skeletal muscle.
19240722 2009 The VEGF pathway and the AKT/mTOR/p70S6K1 signalling pathway in human epithelial ovarian cancer.
19112174 2009 S6 kinase 1 regulates estrogen receptor alpha in control of breast cancer cell proliferation.
19085255 2009 Regulation and localization of ribosomal protein S6 kinase 1 isoforms.
19065636 2009 S6K1 is involved in polyploidization through its phosphorylation at Thr421/Ser424.
18952604 2008 S6K directly phosphorylates IRS-1 on Ser-270 to promote insulin resistance in response to TNF-(alpha) signaling through IKK2.
18925875 2008 mTOR complex 2 (mTORC2) controls hydrophobic motif phosphorylation and activation of serum- and glucocorticoid-induced protein kinase 1 (SGK1).
18829578 2008 Endothelial p70 S6 kinase 1 in regulating tumor angiogenesis.
18813808 2008 Activation of Akt-mTOR-p70S6K pathway in angiogenesis in hepatocellular carcinoma.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18652687 2008 Deciphering downstream gene targets of PI3K/mTOR/p70S6K pathway in breast cancer.
18565837 2008 Resistance exercise decreases eIF2Bepsilon phosphorylation and potentiates the feeding-induced stimulation of p70S6K1 and rpS6 in young men.
18461003 2008 Effects of elevated circulating hormones on resistance exercise-induced Akt signaling.
18423201 2008 SKAR links pre-mRNA splicing to mTOR/S6K1-mediated enhanced translation efficiency of spliced mRNAs.
18092230 2007 Coordinate regulation of ribosome biogenesis and function by the ribosomal protein S6 kinase, a key mediator of mTOR function.
18025271 2007 Roles of human epidermal growth factor receptor 2, c-jun NH2-terminal kinase, phosphoinositide 3-kinase, and p70 S6 kinase pathways in regulation of cyclin G2 expression in human breast cancer cells.
17936702 2007 S6K1-mediated disassembly of mitochondrial URI/PP1gamma complexes activates a negative feedback program that counters S6K1 survival signaling.
17908691 2007 Rapamycin promotes vascular smooth muscle cell differentiation through insulin receptor substrate-1/phosphatidylinositol 3-kinase/Akt2 feedback signaling.
17622239 2007 Increased phosphorylation of p70 S6 kinase is associated with HPV16 infection in cervical cancer and esophageal cancer.
17616691 2007 AKT1 amplification regulates cisplatin resistance in human lung cancer cells through the mammalian target of rapamycin/p70S6K1 pathway.
17604271 2007 PRAS40 is a target for mammalian target of rapamycin complex 1 and is required for signaling downstream of this complex.
17599906 2007 PRR5, a novel component of mTOR complex 2, regulates platelet-derived growth factor receptor beta expression and signaling.
17569770 2007 Blood flow restriction during low-intensity resistance exercise increases S6K1 phosphorylation and muscle protein synthesis.
17446865 2007 Mechanism for activation of the growth factor-activated AGC kinases by turn motif phosphorylation.
17427199 2007 MEK/ERK-dependent uPAR expression is required for motility via phosphorylation of P70S6K in human hepatocarcinoma cells.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17336708 2007 Monitoring antitumor efficacy of rapamycin in Kaposi sarcoma.
17310252 2007 The gene encoding the splicing factor SF2/ASF is a proto-oncogene.
17255101 2007 p21-activated kinase 1 is activated through the mammalian target of rapamycin/p70 S6 kinase pathway and regulates the replication of hepatitis C virus in human hepatoma cells.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17053147 2006 S6K1- and betaTRCP-mediated degradation of PDCD4 promotes protein translation and cell growth.
17052453 2006 S6K1 regulates GSK3 under conditions of mTOR-dependent feedback inhibition of Akt.
17045920 2006 Reactive oxygen species regulate epidermal growth factor-induced vascular endothelial growth factor and hypoxia-inducible factor-1alpha expression through activation of AKT and P70S6K1 in human ovarian cancer cells.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16962100 2007 Acetaldehyde promotes rapamycin-dependent activation of p70(S6K) and glucose uptake despite inhibition of Akt and mTOR in dopaminergic SH-SY5Y human neuroblastoma cells.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16914728 2006 Turnover of the active fraction of IRS1 involves raptor-mTOR- and S6K1-dependent serine phosphorylation in cell culture models of tuberous sclerosis.
16895915 2006 Nuclear export of S6K1 II is regulated by protein kinase CK2 phosphorylation at Ser-17.
16883576 2006 A downstream kinase of the mammalian target of rapamycin, p70S6K1, regulates human double minute 2 protein phosphorylation and stability.
16839745 2006 Role of PI3K and AKT specific isoforms in ovarian cancer cell migration, invasion and proliferation through the p70S6K1 pathway.
16826166 2006 Ganglioside GM3 promotes carcinoma cell proliferation via urokinase plasminogen activator-induced extracellular signal-regulated kinase-independent p70S6 kinase signaling.
16818690 2006 Prognostic associations of activated mitogen-activated protein kinase and Akt pathways in glioblastoma.
16763566 2006 The mTOR/PI3K and MAPK pathways converge on eIF4B to control its phosphorylation and activity.
16715128 2006 Rapamycin inhibits cell motility by suppression of mTOR-mediated S6K1 and 4E-BP1 pathways.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16469801 2006 Activation of p70S6K induces expression of matrix metalloproteinase 9 associated with hepatocyte growth factor-mediated invasion in human ovarian cancer cells.
16434552 2006 Increase in S6K1 phosphorylation in human skeletal muscle following resistance exercise occurs mainly in type II muscle fibers.
16407298 2006 A nuclear transport signal in mammalian target of rapamycin is critical for its cytoplasmic signaling to S6 kinase 1.
16286006 2005 mTOR and S6K1 mediate assembly of the translation preinitiation complex through dynamic protein interchange and ordered phosphorylation events.
16262259 2005 Cooperative regulation of p70S6 kinase by receptor tyrosine kinases and G protein-coupled receptors augments airway smooth muscle growth.
16049009 2005 hVps34 is a nutrient-regulated lipid kinase required for activation of p70 S6 kinase.
15953364 2005 mTOR/p70S6k signalling alteration by Abeta exposure as well as in APP-PS1 transgenic models and in patients with Alzheimer's disease.
15899889 2005 Phosphorylation of mammalian target of rapamycin (mTOR) at Ser-2448 is mediated by p70S6 kinase.
15843522 2005 IL-2 increases human telomerase reverse transcriptase activity transcriptionally and posttranslationally through phosphatidylinositol 3'-kinase/Akt, heat shock protein 90, and mammalian target of rapamycin in transformed NK cells.
15812314 2005 Zinc induces neurofilament phosphorylation independent of p70 S6 kinase in N2a cells.
15809305 2005 Structure of S6 kinase 1 determines whether raptor-mTOR or rictor-mTOR phosphorylates its hydrophobic motif site.
15790787 2005 Differential regulation of the p70 S6 kinase pathway by interferon alpha (IFNalpha) and imatinib mesylate (STI571) in chronic myelogenous leukemia cells.
15723049 2005 Atrophy of S6K1(-/-) skeletal muscle cells reveals distinct mTOR effectors for cell cycle and size control.
15696579 2005 Phosphorylated osteopontin promotes migration of human choriocarcinoma cells via a p70 S6 kinase-dependent pathway.
15692808 2005 Regulation of insulin signalling by hyperinsulinaemia: role of IRS-1/2 serine phosphorylation and the mTOR/p70 S6K pathway.
15659381 2005 Characterization of a conserved C-terminal motif (RSPRR) in ribosomal protein S6 kinase 1 required for its mammalian target of rapamycin-dependent regulation.
15623621 2004 mTOR and P70 S6 kinase expression in primary liver neoplasms.
15589845 2004 Specific interaction between S6K1 and CoA synthase: a potential link between the mTOR/S6K pathway, CoA biosynthesis and energy metabolism.
15533996 2004 Balancing Akt with S6K: implications for both metabolic diseases and tumorigenesis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15474452 2004 SU5416 inhibited VEGF and HIF-1alpha expression through the PI3K/AKT/p70S6K1 signaling pathway.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15341740 2004 SKAR is a specific target of S6 kinase 1 in cell growth control.
15319361 2004 Impaired anabolic response of muscle protein synthesis is associated with S6K1 dysregulation in elderly humans.
15314020 2004 Upstream and downstream of mTOR.
15304500 2004 Autocrine transforming growth factor alpha regulates cell adhesion by multiple signaling via specific phosphorylation sites of p70S6 kinase in colon cancer cells.
15236312 2004 ERBB2, TBX2, RPS6KB1, and MYC alterations in breast tissues of BRCA1 and BRCA2 mutation carriers.
15203190 2004 GPx-1 modulates Akt and P70S6K phosphorylation and Gadd45 levels in MCF-7 cells.
15158097 2004 Ribosomal p70S6K basal activity increases upon induction of differentiation of myelomonocytic leukemic cell lines HL60, AML14 and MPD.
15071500 2004 Phosphorylation of eucaryotic translation initiation factor 4B Ser422 is modulated by S6 kinases.
15028555 2004 G1 cell cycle progression and the expression of G1 cyclins are regulated by PI3K/AKT/mTOR/p70S6K1 signaling in human ovarian cancer cells.
15024086 2004 A novel mTOR-regulated phosphorylation site in elongation factor 2 kinase modulates the activity of the kinase and its binding to calmodulin.
14709557 2004 Stimulation of the AMP-activated protein kinase leads to activation of eukaryotic elongation factor 2 kinase and to its phosphorylation at a novel site, serine 398.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14673156 2004 mTOR controls cell cycle progression through its cell growth effectors S6K1 and 4E-BP1/eukaryotic translation initiation factor 4E.
12869548 2003 Identification of dominant negative mutants of Rheb GTPase and their use to implicate the involvement of human Rheb in the activation of p70S6K.
12801526 2003 Tumor necrosis factor receptor-associated factor (TRAF) 4 is a new binding partner for the p70S6 serine/threonine kinase.
12759354 2003 Activation of the p70 S6 kinase and phosphorylation of the 4E-BP1 repressor of mRNA translation by type I interferons.
12747804 2003 Muscarinic receptor-mediated activation of p70 S6 kinase 1 (S6K1) in 1321N1 astrocytoma cells: permissive role of phosphoinositide 3-kinase.
12733712 2003 Increased expression of phosphorylated p70S6 kinase and Akt in papillary thyroid cancer tissues.
12586835 2003 Mitotic regulation of ribosomal S6 kinase 1 involves Ser/Thr, Pro phosphorylation of consensus and non-consensus sites by Cdc2.
12529391 2003 Protein kinase C phosphorylates ribosomal protein S6 kinase betaII and regulates its subcellular localization.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12150926 2002 Raptor, a binding partner of target of rapamycin (TOR), mediates TOR action.
12054624 2002 Molecular crosstalk between p70S6k and MAPK cell signaling pathways.
12052877 2002 Targeting protein phosphatase 1 (PP1) to the actin cytoskeleton: the neurabin I/PP1 complex regulates cell morphology.
12023960 2002 Molecular basis for the substrate specificity of NIMA-related kinase-6 (NEK6). Evidence that NEK6 does not phosphorylate the hydrophobic motif of ribosomal S6 protein kinase and serum- and glucocorticoid-induced protein kinase in vivo.
12019261 2002 VIIa/tissue factor interaction results in a tissue factor cytoplasmic domain-independent activation of protein synthesis, p70, and p90 S6 kinase phosphorylation.
12014987 2002 The Src-family tyrosine kinase inhibitor PP1 interferes with the activation of ribosomal protein S6 kinases.
11914378 2002 Regulation of an activated S6 kinase 1 variant reveals a novel mammalian target of rapamycin phosphorylation site.
11774034 Overexpressed genes/ESTs and characterization of distinct amplicons on 17q23 in breast cancer cells.
11516946 2001 Identification of the NIMA family kinases NEK6/7 as regulators of the p70 ribosomal S6 kinase.
11500364 2001 Regulation of elongation factor 2 kinase by p90(RSK1) and p70 S6 kinase.
11438723 2001 Visualization of biochemical networks in living cells.
11331760 2001 Comprehensive copy number and gene expression profiling of the 17q23 amplicon in human breast cancer.
11297520 2001 Phosphorylation of the protein kinase mutated in Peutz-Jeghers cancer syndrome, LKB1/STK11, at Ser431 by p90(RSK) and cAMP-dependent protein kinase, but not its farnesylation at Cys(433), is essential for LKB1 to suppress cell vrowth.
11013237 2001 Regulation of glycogen synthesis by amino acids in cultured human muscle cells.
10973943 2000 Cdc42 stimulates RNA splicing via the S6 kinase and a novel S6 kinase target, the nuclear cap-binding complex.
10601311 1999 Evidence that 3-phosphoinositide-dependent protein kinase-1 mediates phosphorylation of p70 S6 kinase in vivo at Thr-412 as well as Thr-252.
10197603 1999 Localization of PS6K to chromosomal region 17q23 and determination of its amplification in breast cancer.
9804755 1998 Molecular cloning and characterization of a novel p70 S6 kinase, p70 S6 kinase beta containing a proline-rich region.
9653190 1998 Neurabin is a synaptic protein linking p70 S6 kinase and the neuronal cytoskeleton.
9445476 1998 Phosphorylation and activation of p70s6k by PDK1.
9427642 1998 3-Phosphoinositide-dependent protein kinase 1 (PDK1) phosphorylates and activates the p70 S6 kinase in vivo and in vitro.
9271440 1997 Dual requirement for a newly identified phosphorylation site in p70s6k.
8871403 1996 p70 S6 kinase: an enigma with variations.
1922062 1991 Cloning and expression of two human p70 S6 kinase polypeptides differing only at their amino termini.