Property Summary

NCBI Gene PubMed Count 78
PubMed Score 86.71
PubTator Score 76.38

Knowledge Summary

Patent (10,862)

Expression

  Differential Expression (19)

Disease log2 FC p
malignant mesothelioma 2.800 3.8e-08
osteosarcoma -3.391 2.1e-10
glioblastoma -2.500 1.0e-04
atypical teratoid / rhabdoid tumor -2.200 3.8e-05
medulloblastoma, large-cell -2.100 6.9e-03
Amyotrophic Lateral Sclerosis 1.019 6.7e-06
acute quadriplegic myopathy 1.207 8.0e-05
tuberculosis and treatment for 3 months 1.200 1.0e-03
lung cancer -1.100 2.4e-03
active ulcerative colitis -1.209 2.5e-02
diabetes mellitus -1.300 8.9e-03
cystic fibrosis -1.400 4.1e-04
pediatric high grade glioma -2.000 2.1e-04
pilocytic astrocytoma -1.700 1.3e-03
subependymal giant cell astrocytoma -3.222 4.6e-03
Endometriosis -1.048 1.1e-02
Breast cancer -1.800 7.8e-12
ovarian cancer -1.300 1.8e-04
chronic rhinosinusitis -1.298 4.5e-03

 GWAS Trait (1)

Protein-protein Interaction (4)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (41)

PMID Text
26109721 KSHV activates the MSK1/2-CREB1 pathway during primary infection and that it depends on this pathway for viral lytic replication. I
26030901 Interrupting MSK1 activation is a new target for antioxidants.
25958199 Increased MSK1 activity is critically important for Epstein-Barr virus LMP1-promoted cell proliferation and transformation.
25520509 Authors conclude that paramyxoviruses trigger the DNA damage response, a pathway required for MSK1 activation of phospho Ser 276 RelA formation to trigger the IRF7-RIG-I amplification loop necessary for mucosal interferon production.
24953041 These results highlight the relevance of MSK1 in the up-regulation of RARbeta by prostaglandin E2.
24792438 Data suggest that MSK1 and MSK2 are the major CREB kinases in fibroblast-like synoviocytes from rheumatoid arthritis patients stimulated with lysophosphatidic acid and that phosphorylation of CREB1 at Ser-133 plays a significant role in IL-8 production.
23675462 MSK1 and MSK2 are required for maximal TFF 1 induction.
23643942 Angiopoietin 2-mediated signaling via survivin/ref-1/MSK-1 pathway promotes doxorubicin resistance in HepG2 cells.
23604116 MSK1 plays an important role for hormone-dependent breast cancer growth
23047923 In vitro protein-protein interaction analysis identifies a Vpu-binding host protein ribosomal protein S6 kinase, 90kDa, polypeptide 5 (RPS6KA5, MSK1)
22626465 Astaxanthin attenuates the UVB-induced secretion of prostaglandin E2 and interleukin-8 in human keratinocytes by interrupting MSK1 phosphorylation in a ROS depletion-independent manner
22312446 MSK1 is an important downstream kinase involved in CS-induced NF-kappaB activation
21282660 MSK1 is a direct and potent transcriptional activator when targeted to c-fos promotor, and when targeted to alpha-globin promoter induces H3 S28 phosphorylation reactivating expression of this polycomb-silenced gene.
20864036 MSK1- and MSK2-mediated H3K27me3S28 phosphorylation serves as a mechanism to activate a subset of PcG target genes determined by the biological stimuli and thereby modulate the gene expression program determining cell fate.
20805296 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20433920 In vitro protein-protein interaction analysis identifies a Vpu-binding host protein ribosomal protein S6 kinase, 90kDa, polypeptide 5 (RPS6KA5, MSK1)
20408143 In this study, by applying a novel method, we have identified the phosphorylation sites in human MSK1 mitogen- and stress-activated protein kinase 1, and show that MRK-beta could also activate MSK1 through direct interaction.
20406806 MiR-148a attenuates paclitaxel resistance of hormone-refractory, drug-resistant prostate cancer PC3 cells by regulating MSK1 expression
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20354165 Observational study of gene-disease association. (HuGE Navigator)
20200978 Observational study of gene-disease association. (HuGE Navigator)
20198339 Bile acid regulates MUC2 transcription in colon cancer cells via positive EGFR/PKC/Ras/ERK/CREB, PI3K/Akt/IkappaB/NF-kappaB and p38/MSK1/CREB pathways and negative JNK/c-Jun/AP-1 pathway.
20089855 CREB controls MSK1-mediated phosphorylation of histone H3 at the c-fos promoter in vitro
20044958 The MSK1 can be phosphorylated and activated in cells by both ERK1/2 and p38alpha.
19933278 MSK1 and MSK2 are differentially regulated by CK2 during the UV response and that MSK2 is the major protein kinase responsible for the UV-induced phosphorylation of p65 at Ser(276) that positively regulates NF-kappaB activity in MDA-MB-231 cells
19706715 We conclude that RSV induces RelA activation in the innate inflammatory response via a pathway separate from that controlling RelA cytoplasmic release, mediated by ROS signaling to cytoplasmic MSK1 activation and RelA Ser-276 phosphorylation.
19672773 Data provide evidence that p38 Map kinase pathway is activated leading to increased upregulation of mixed lineage kinase 3, MKK3/6, MSK1, and Mapkapk2, upon treatment of BCR/ABL expressing cells with dasatinib.
19633291 Data reveal that TPA activates transcription of TBX2 through activating MSK1, which leads to an increase in phosphorylated histone H3 and the recruitment of Sp1 to the TBX2 gene.
19251839 IL-17F may be involved in airway inflammation and remodeling via the induction of IL-11, and RafI-MEK1/2-ERK1/2-MSK1-CREB is identified as a novel signaling pathway.
19197368 This study provides therefore a direct link between MSK1-mediated phosphorylation of Ser276 p65 of NF-kappaB, allowing its binding to the SCF intronic enhancer, and pathophysiological SCF expression in inflammation.
19015318 the action of 1,25(OH)(2)D(3) on colon carcinoma cells depends on the dual action of VDR as a transcription factor and a nongenomic activator of RhoA-ROCK and p38MAPK-MSK1.
18424438 the induction of inflammatory genes by farnesol is mediated by the activation of the NF-kappaB pathway and involves MEK1/2-ERK1/2-MSK1-dependent phosphorylation of p65/RelA(Ser(276))
17495961 Dimethylfumarate specifically inhibits MSK1 and 2 activations and subsequently inhibits NF-kappaB-induced gene-transcriptions, which are believed to be important in the pathogenesis of psoriasis
17117922 Thr700 phosphorylation relieves the inhibition of MSK1 by a C-terminal autoinhibitory helix and helps induce a conformational shift that protects Thr581 from dephosphorylation
16762916 MSK1 has a role downstream of p38 in the regulation of As2O3 responses
16543895 As MSK1 regulates the production of pro-inflammatory cytokines, it may play a role in the pathogenesis of psoriasis.
16532028 Plays a positive role in the control of cell proliferation of both HaCaT keratinocytes and the A431 human epidermoid carcinoma line.
16479592 essential role of the C-terminal domain of MSK1 for its constitutive interaction with group V secretory phospholipase A(2), which appears essential to support VEGF-mediated PAF synthesis
15133024 MSK1 has a role in transforming growth factor-beta-mediated responses through p38alpha and Smad signaling pathways
15010469 acetylation of histones may stimulate transcription by suppressing an inhibitory phosphorylation by MSK1
12690113 IL1beta and TNFalpha activation of MSK1 and CREB and cAMP-response element signaling cascades occurs via ERK/p38 MAP kinases and are crucial aspects of the intracellular mechanisms that mediate MUC5AC gene expression

AA Sequence

MEEEGGSSGGAAGTSADGGDGGEQLLTVKHELRTANLTGHAEKVGIENFELLKVLGTGAYGKVFLVRKIS      1 - 70
GHDTGKLYAMKVLKKATIVQKAKTTEHTRTERQVLEHIRQSPFLVTLHYAFQTETKLHLILDYINGGELF     71 - 140
THLSQRERFTEHEVQIYVGEIVLALEHLHKLGIIYRDIKLENILLDSNGHVVLTDFGLSKEFVADETERA    141 - 210
YSFCGTIEYMAPDIVRGGDSGHDKAVDWWSLGVLMYELLTGASPFTVDGEKNSQAEISRRILKSEPPYPQ    211 - 280
EMSALAKDLIQRLLMKDPKKRLGCGPRDADEIKEHLFFQKINWDDLAAKKVPAPFKPVIRDELDVSNFAE    281 - 350
EFTEMDPTYSPAALPQSSEKLFQGYSFVAPSILFKRNAAVIDPLQFHMGVERPGVTNVARSAMMKDSPFY    351 - 420
QHYDLDLKDKPLGEGSFSICRKCVHKKSNQAFAVKIISKRMEANTQKEITALKLCEGHPNIVKLHEVFHD    421 - 490
QLHTFLVMELLNGGELFERIKKKKHFSETEASYIMRKLVSAVSHMHDVGVVHRDLKPENLLFTDENDNLE    491 - 560
IKIIDFGFARLKPPDNQPLKTPCFTLHYAAPELLNQNGYDESCDLWSLGVILYTMLSGQVPFQSHDRSLT    561 - 630
CTSAVEIMKKIKKGDFSFEGEAWKNVSQEAKDLIQGLLTVDPNKRLKMSGLRYNEWLQDGSQLSSNPLMT    631 - 700
PDILGSSGAAVHTCVKATFHAFNKYKREGFCLQNVDKAPLAKRRKMKKTSTSTETRSSSSESSHSSSSHS    701 - 770
HGKTTPTKTLQPSNPADSNNPETLFQFSDSVA                                          771 - 802
//

Text Mined References (88)

PMID Year Title
26109721 2015 Screening of the Human Kinome Identifies MSK1/2-CREB1 as an Essential Pathway Mediating Kaposi's Sarcoma-Associated Herpesvirus Lytic Replication during Primary Infection.
26030901 2015 UVB Stimulates the Expression of Endothelin B Receptor in Human Melanocytes via a Sequential Activation of the p38/MSK1/CREB/MITF Pathway Which Can Be Interrupted by a French Maritime Pine Bark Extract through a Direct Inactivation of MSK1.
25958199 2015 Mitogen- and stress-activated Kinase 1 mediates Epstein-Barr virus latent membrane protein 1-promoted cell transformation in nasopharyngeal carcinoma through its induction of Fra-1 and c-Jun genes.
25520509 2015 Ataxia telangiectasia mutated kinase mediates NF-?B serine 276 phosphorylation and interferon expression via the IRF7-RIG-I amplification loop in paramyxovirus infection.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
24953041 2014 Prostaglandin E2 induces retinoic acid receptor-? up-regulation through MSK1.
24792438 2014 Lysophosphatidic acid-induced IL-8 secretion involves MSK1 and MSK2 mediated activation of CREB1 in human fibroblast-like synoviocytes.
23675462 2013 Mitogen- and stress-activated protein kinases 1 and 2 are required for maximal trefoil factor 1 induction.
23643942 2013 Angiopoietin2 enhances doxorubin resistance in HepG2 cells by upregulating survivin and Ref-1 via MSK1 activation.
23604116 2014 Activation of mitogen- and stress-activated kinase 1 is required for proliferation of breast cancer cells in response to estrogens or progestins.
22626465 2012 Astaxanthin attenuates the UVB-induced secretion of prostaglandin E2 and interleukin-8 in human keratinocytes by interrupting MSK1 phosphorylation in a ROS depletion-independent manner.
22504420 2012 Genome-wide meta-analysis identifies 56 bone mineral density loci and reveals 14 loci associated with risk of fracture.
22312446 2012 Mitogen- and stress-activated kinase 1 (MSK1) regulates cigarette smoke-induced histone modifications on NF-?B-dependent genes.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21282660 2011 Histone code pathway involving H3 S28 phosphorylation and K27 acetylation activates transcription and antagonizes polycomb silencing.
21269460 2011 Initial characterization of the human central proteome.
20864036 2010 Polycomb group protein displacement and gene activation through MSK-dependent H3K27me3S28 phosphorylation.
20805296 2011 Genetic variants within the MAP kinase signalling network and anti-TNF treatment response in rheumatoid arthritis patients.
20596523 2010 Development and validation of a method for profiling post-translational modification activities using protein microarrays.
20408143 2010 Mapping of phosphorylation sites in human MSK1 activated by a novel interaction with MRK-beta.
20406806 2010 MiR-148a attenuates paclitaxel resistance of hormone-refractory, drug-resistant prostate cancer PC3 cells by regulating MSK1 expression.
20382163 2010 The crystal structure of the active form of the C-terminal kinase domain of mitogen- and stress-activated protein kinase 1.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20354165 2010 Energy balance, the PI3K-AKT-mTOR pathway genes, and the risk of bladder cancer.
20200978 2010 Replication of previous genome-wide association studies of bone mineral density in premenopausal American women.
20198339 2010 Bile acid regulates MUC2 transcription in colon cancer cells via positive EGFR/PKC/Ras/ERK/CREB, PI3K/Akt/IkappaB/NF-kappaB and p38/MSK1/CREB pathways and negative JNK/c-Jun/AP-1 pathway.
20089855 2010 cAMP-response element-binding protein (CREB) controls MSK1-mediated phosphorylation of histone H3 at the c-fos promoter in vitro.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20044958 2009 Casein kinase 2 interacts with human mitogen- and stress-activated protein kinase MSK1 and phosphorylates it at multiple sites.
20018936 2010 Phosphorylation and acetylation of histone H3 and autoregulation by early growth response 1 mediate interleukin 1beta induction of early growth response 1 transcription.
19933278 2010 Differential regulation of mitogen- and stress-activated protein kinase-1 and -2 (MSK1 and MSK2) by CK2 following UV radiation.
19706715 2009 Respiratory syncytial virus infection induces a reactive oxygen species-MSK1-phospho-Ser-276 RelA pathway required for cytokine expression.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19672773 2009 Activation of the p38 Map kinase pathway is essential for the antileukemic effects of dasatinib.
19633291 2009 Phosphorylation of histone H3 by protein kinase C signaling plays a critical role in the regulation of the developmentally important TBX2 gene.
19464896 2009 The versatile role of MSKs in transcriptional regulation.
19251839 2009 IL-17F-induced IL-11 release in bronchial epithelial cells via MSK1-CREB pathway.
19197368 2009 Ser276 phosphorylation of NF-kB p65 by MSK1 controls SCF expression in inflammation.
19015318 2008 RhoA-ROCK and p38MAPK-MSK1 mediate vitamin D effects on gene expression, phenotype, and Wnt pathway in colon cancer cells.
18511904 2008 Altered subcellular distribution of MSK1 induced by glucocorticoids contributes to NF-kappaB inhibition.
18508628 2008 MSK activation and physiological roles.
18424438 2008 NF-kappaB-dependent transcriptional activation in lung carcinoma cells by farnesol involves p65/RelA(Ser276) phosphorylation via the MEK-MSK1 signaling pathway.
18385332 2008 Protein kinase A-induced phosphorylation of the p65 subunit of nuclear factor-kappaB promotes Schwann cell differentiation into a myelinating phenotype.
17495961 2007 Dimethylfumarate specifically inhibits the mitogen and stress-activated kinases 1 and 2 (MSK1/2): possible role for its anti-psoriatic effect.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17117922 2007 Identification of novel phosphorylation sites in MSK1 by precursor ion scanning MS.
16762916 2006 Activation of the mitogen- and stress-activated kinase 1 by arsenic trioxide.
16543895 2006 Mitogen- and stress-activated protein kinase 1 is activated in lesional psoriatic epidermis and regulates the expression of pro-inflammatory cytokines.
16532028 2006 Mitogen- and stress-activated protein kinase 1 is critical for interleukin-1-induced, CREB-mediated, c-fos gene expression in keratinocytes.
16479592 2006 Role of MSK1 in the signaling pathway leading to VEGF-mediated PAF synthesis in endothelial cells.
16223362 2006 Nur77 is phosphorylated in cells by RSK in response to mitogenic stimulation.
15568999 2005 MSK1 activity is controlled by multiple phosphorylation sites.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15276183 2004 MD-2: the Toll 'gatekeeper' in endotoxin signalling.
15274926 2004 The structure of MSK1 reveals a novel autoinhibitory conformation for a dual kinase protein.
15133024 2004 Evidence for a role of MSK1 in transforming growth factor-beta-mediated responses through p38alpha and Smad signaling pathways.
15010469 2004 Phosphorylation of histone H2A inhibits transcription on chromatin templates.
14963018 2004 Evidence of STAT1 phosphorylation modulated by MAPKs, MEK1 and MSK1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14578350 2004 Role of p38alpha Map kinase in Type I interferon signaling.
14551213 2003 Constitutively active Galpha16 stimulates STAT3 via a c-Src/JAK- and ERK-dependent mechanism.
12807421 2003 Mitogen and stress response kinase-1 (MSK1) mediates excitotoxic induced death of hippocampal neurones.
12773393 2003 MSK2 and MSK1 mediate the mitogen- and stress-induced phosphorylation of histone H3 and HMG-14.
12763138 2003 Erythropoietin-induced serine 727 phosphorylation of STAT3 in erythroid cells is mediated by a MEK-, ERK-, and MSK1-dependent pathway.
12690113 2003 Interleukin-1 beta and tumor necrosis factor-alpha induce MUC5AC overexpression through a mechanism involving ERK/p38 mitogen-activated protein kinases-MSK1-CREB activation in human airway epithelial cells.
12628924 2003 Transcriptional activation of the NF-kappaB p65 subunit by mitogen- and stress-activated protein kinase-1 (MSK1).
12576423 2003 Tissue microarray analysis of signal transducers and activators of transcription 3 (Stat3) and phospho-Stat3 (Tyr705) in node-negative breast cancer shows nuclear localization is associated with a better prognosis.
12569367 2003 Regulation of the ER81 transcription factor and its coactivators by mitogen- and stress-activated protein kinase 1 (MSK1).
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12421349 2002 Regulation of tyrosine hydroxylase by stress-activated protein kinases.
11994045 2002 Phosphorylation and activation of mitogen- and stress-activated protein kinase-1 in adult rat cardiac myocytes by G-protein-coupled receptor agonists requires both extracellular-signal-regulated kinase and p38 mitogen-activated protein kinase.
11909979 2002 MSK1 and MSK2 are required for the mitogen- and stress-induced phosphorylation of CREB and ATF1 in fibroblasts.
11777913 2002 Phosphorylation of 4E-BP1 is mediated by the p38/MSK1 pathway in response to UVB irradiation.
11350938 2001 Protein kinase PKR is required for platelet-derived growth factor signaling of c-fos gene expression via Erks and Stat3.
11297520 2001 Phosphorylation of the protein kinase mutated in Peutz-Jeghers cancer syndrome, LKB1/STK11, at Ser431 by p90(RSK) and cAMP-dependent protein kinase, but not its farnesylation at Cys(433), is essential for LKB1 to suppress cell vrowth.
11018520 2000 MSK1 is required for CREB phosphorylation in response to mitogens in mouse embryonic stem cells.
10978317 2000 Serine 727 phosphorylation and activation of cytosolic phospholipase A2 by MNK1-related protein kinases.
10880354 2000 Regulation of BAD by cAMP-dependent protein kinase is mediated via phosphorylation of a novel site, Ser155.
10702687 1999 Assignment of a member of the ribosomal protein S6 kinase family, RPS6KA5, to human chromosome 14q31-->q32.1 by radiation hybrid mapping.
10635333 1999 Phosphorylation of rat serine 105 or mouse threonine 217 in C/EBP beta is required for hepatocyte proliferation induced by TGF alpha.
10521505 1999 Serine phosphorylation and negative regulation of Stat3 by JNK.
10469656 1999 The nucleosomal response associated with immediate-early gene induction is mediated via alternative MAP kinase cascades: MSK1 as a potential histone H3/HMG-14 kinase.
9873047 1999 Cloning and characterization of RLPK, a novel RSK-related protein kinase.
9872331 1998 Repression of Stat3 activity by activation of mitogen-activated protein kinase (MAPK).
9687510 1998 Mitogen- and stress-activated protein kinase-1 (MSK1) is directly activated by MAPK and SAPK2/p38, and may mediate activation of CREB.
9343414 1997 STAT3 serine phosphorylation by ERK-dependent and -independent pathways negatively modulates its tyrosine phosphorylation.