Property Summary

Ligand Count 4
NCBI Gene PubMed Count 30
PubMed Score 12.61
PubTator Score 9.22

Knowledge Summary

Patent (8,100)

TINX Plot

  Disease (4)

Disease Target Count P-value
psoriasis 6694 1.2e-27
group 3 medulloblastoma 4104 8.5e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Diabetic polyneuropathy 3 3.306 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
group 3 medulloblastoma -1.400 8.5e-05
psoriasis 1.100 1.2e-27

Gene RIF (8)

AA Sequence

MGDEDDDESCAVELRITEANLTGHEEKVSVENFELLKVLGTGAYGKVFLVRKAGGHDAGKLYAMKVLRKA      1 - 70
ALVQRAKTQEHTRTERSVLELVRQAPFLVTLHYAFQTDAKLHLILDYVSGGEMFTHLYQRQYFKEAEVRV     71 - 140
YGGEIVLALEHLHKLGIIYRDLKLENVLLDSEGHIVLTDFGLSKEFLTEEKERTFSFCGTIEYMAPEIIR    141 - 210
SKTGHGKAVDWWSLGILLFELLTGASPFTLEGERNTQAEVSRRILKCSPPFPPRIGPVAQDLLQRLLCKD    211 - 280
PKKRLGAGPQGAQEVRNHPFFQGLDWVALAARKIPAPFRPQIRSELDVGNFAEEFTRLEPVYSPPGSPPP    281 - 350
GDPRIFQGYSFVAPSILFDHNNAVMTDGLEAPGAGDRPGRAAVARSAMMQDSPFFQQYELDLREPALGQG    351 - 420
SFSVCRRCRQRQSGQEFAVKILSRRLEANTQREVAALRLCQSHPNVVNLHEVHHDQLHTYLVLELLRGGE    421 - 490
LLEHIRKKRHFSESEASQILRSLVSAVSFMHEEAGVVHRDLKPENILYADDTPGAPVKIIDFGFARLRPQ    491 - 560
SPGVPMQTPCFTLQYAAPELLAQQGYDESCDLWSLGVILYMMLSGQVPFQGASGQGGQSQAAEIMCKIRE    561 - 630
GRFSLDGEAWQGVSEEAKELVRGLLTVDPAKRLKLEGLRGSSWLQDGSARSSPPLRTPDVLESSGPAVRS    631 - 700
GLNATFMAFNRGKREGFFLKSVENAPLAKRRKQKLRSATASRRGSPAPANPGRAPVASKGAPRRANGPLP    701 - 770
PS                                                                        771 - 772
//

Text Mined References (40)

PMID Year Title