Property Summary

NCBI Gene PubMed Count 131
PubMed Score 311.16
PubTator Score 163.26

Knowledge Summary

Patent (52,461)

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis 1.200 1.1e-03
osteosarcoma 1.401 7.8e-03
medulloblastoma, large-cell -1.300 1.7e-05
pancreatic ductal adenocarcinoma liver m... -1.551 1.1e-02
intraductal papillary-mucinous adenoma (... 1.200 2.5e-02
group 4 medulloblastoma -1.200 1.9e-03
Breast cancer -2.300 4.8e-14
ovarian cancer -2.300 1.5e-06
pancreatic cancer 1.200 3.1e-03

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (62)

PMID Text
26977024 RSK1 and 3 but not RSK2 are down-regulated in breast tumour and are associated with disease progression. RSK may be a key component in the progression and metastasis of breast cancer.
26625210 Data show that the 90 kDa ribosomal protein S6 kinases RSK1 and RSK2 play a key role in the homing of ovarian cancer cells in metastatic sites by regulating cell adhesion and invasion.
26354035 This case is one of the few examples where RPS6KA3 mutations are associated with a non-specific X-linked mental retardation.
26297997 This is the first report of exon skipping from an exonic mutation of RPS6KA3, demonstrating that a missense mutation and concomitant disruption of normal splicing contribute to the manifestation of CLS
26158630 Results indicate that the phosphorylation of EphA2 at Ser-897 is controlled by RSK and the RSK-EphA2 axis might contribute to cell motility and promote tumour malignant progression.
25992613 miR-191 represses proliferation in primary human fibroblasts via targeting multiple proto-oncogenes, including CDK9, NOTCH2, and RPS6KA3.
25889895 SL0101 and BI-D1870 induce distinct off-target effects in mTORC1-p70S6K signaling, and thus, the functions previously ascribed to RSK1/2 based on these inhibitors should be reassessed.
25855080 Study identifies RSK2 as a new kinase that regulates NHE3 activity by direct phosphorylation.
25624005 Rsk2-mediated inhibition of hyperplasia has now been demonstrated to occur in the arthritic synovium.
25044551 RPS6KA3 in three unrelated Coffin-Lowry syndrome patients including one from the historical Coffin-Lowry syndrome family and found two novel mutations, were analyzed.
25002506 14-3-3 binding promotes PDCD4 degradation, suggesting an important role for RSK in the inactivation of PDCD4 in melanoma.
24719417 Kaposi's sarcoma-associated herpesvirus ORF45 mediates activation of the HIV-1 long terminal repeat via RSK2.
24719417 RSK2 is selectively involved in LTR stimulation by the HIV-1 Tat protein, but constitutively active RSK2 is unable to stimulate the LTR
24416220 RSK2 regulates craniofacial development including tooth development and patterning via novel transcriptional targets
24311527 This report also suggests that there is no genotype-phenotype correlation between the location and type of RPS6KA3 gene mutations and SIDEs.
24284076 our results identify the integrin-RSK signaling axis as an important regulator of cytokinesis in epithelial cells
24141780 Activated RSK2 directly interacts with and phosphorylates FGFR1, thereby modulating receptor signaling through regulation of endocytosis.
24086335 findings demonstrated that RSK2 plays an important role in the DNA damage pathway that maintains genomic stability by mediating cell cycle progression and DNA repair
24085294 protein effectors of the RSK2-CREB-Fascin-1 pathway represent promising biomarkers and therapeutic targets in the clinical prognosis and treatment of metastatic human cancers.
23608533 RSK2 functions as a signal integrator to provide antianoikis protection to cancer cells in both transcription-independent and -dependent manners, in part by signaling through ASK1 and CREB, and contributes to cancer cell invasion and tumor metastasis.
23541530 Data indicate that the N-terminal kinase domain of p90 ribosomal S6 kinase, isoform 2, binds three different flavonol rhamnosides in a highly unusual manner, distinct from other kinase inhibitor interactions.
23329845 ILKAP is a nuclear protein that regulates cell survival and apoptosis through the regulation of RSK2 signaling.
23118220 These results reveal RSK2 as a key regulator of integrin activity and provide a novel mechanism by which it may promote cell migration and cancer metastasis.
23041051 Results indicate that RSK2 is regulated in response to cisplatin treatment, and this downregulation may contribute to the cytotoxic action of cisplatin.
22918890 RSK2 plays a key role in neoplastic transformation of human skin cells and in skin cancer growth.
22685297 Epidermal growth factor (EGF) induces ribosomal S6 kinase 2 (RSK2) ubiquitination, and knocking down TRAF2 suppresses ubiquitination of RSK2 induced by EGF
22031759 the results highlight a novel role for RSK1/2 and HSP27 phosphoproteins in P. aeruginosa-dependent induction of transcription of the IL-8 gene in human bronchial epithelial cells.
21930553 To our knowledge, this is the first family identified with a submicroscopic duplication including the entire RPS6KA3/RSK2 gene, and our findings suggest that an increased dose of this gene is responsible for a mild form of NS-XLID.
21619683 MSP-induced RSK2 activation is a critical determinant linking RON signaling to cellular EMT program.
21501342 Data show that SH3P2 was phosphorylated on Ser(202) by ribosomal S6 kinase (RSK) in an ERK pathway-dependent manner, and such phosphorylation inhibited the ability of SH3P2 to suppress cell motility.
21183680 data provide a direct link between RSK2 and caspase-8 and identify a novel molecular mechanism for caspase-8 modulation by RSK2
21061166 RSK2 could regulate neurotransmitter release by activating phospholipase D production of lipids required for exocytosis.
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20385620 Data show that RSK2 is activated by treatment with tumor necrosis factor-alpha (TNF-alpha) and directly phosphorylates IkappaBalpha at Ser-32, leading to IkappaBalpha degradation.
20383198 the involvement of Rsk2 in the activation and maintenance of the spindle assembly checkpoint in metaphase II-arrested Xenopus egg extracts and in human cells
20234090 p90 ribosomal S6 kinase 2 promotes invasion and metastasis of human head and neck squamous cell carcinoma cells.
19716794 RSK is a principal effector of the RAS-ERK pathway for eliciting a coordinate promotile/invasive gene program and phenotype in epithelial cells.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19435896 Targeting RSK2 with natural compounds, such as kaempferol, in cancer cells may be a good strategy for chemopreventive or chemotherapeutic application.
19150432 betaTrCP promotes cell survival in cooperation with the ERK-RSK pathway by targeting BimEL for degradation.
19129453 The authors found that knockdown of RSK2 enhanced influenza virus polymerase activity and growth of influenza viruses.
18976975 Knockdown of ribosomal protein S6 kinase, polypeptide 3 (RPS6KA3) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18775331 Reults describe codependent functions of RSK2 and the apoptosis-promoting factor TIA-1 in stress granule assembly and cell survival.
18722121 RSK1 and RSK2 are required for Raptor phosphorylation in vivo and directly phosphorylate Raptor in vitro.
18156174 Src-dependent phosphorylation at Tyr-529 facilitates inactive ERK binding to RSK2, which might be a general requirement for RSK2 activation by EGF through the MEK/ERK pathway.
17938253 an essential nonredundant role of Rsk2 in T-cell activation.
17318637 Cerebellum and hippocampus volumes were particularly impacted by Coffin-Lowry syndrome and may be associated with specific interfamilial RSK2 mutations.
17225856 Data identify a novel reciprocal regulation of Tat and RSK2 function, which might serve to induce early changes in the chromatin organization of the HIV LTR.
17225856 RSK2 is selectively involved in LTR stimulation by the HIV-1 Tat protein, but constitutively active RSK2 is unable to stimulate the LTR
17213202 RSK2 is an important kinase for NFAT3 in mediating myotube differentiation
17100996 Mutations in the RSK2(RPS6KA3) gene cause Coffin-Lowry syndrome and nonsyndromic X-linked mental retardation.
16879200 we present 44 novel mutations in RSK2 gene causing Coffin-Lowry syndrome
16691578 A novel RSK2 (RPS6KA3) gene mutation is associated with abnormal brain MRI findings in a family with Coffin-Lowry syndrome.
15833840 RSK2 levels are higher in human prostate cancers compared with normal prostate; increased RSK2 levels may participate in the rise in PSA expression seen in prostate cancer. Proliferation of prostate cancer cells may be dependent on RSK2 activity.
14973203 Investigation of the mechanisms underlying aberrant splicing of RSK2 mRNA.
14678837 Expression pattern during development suggests it may be involved in cognitive impairment and facial dysmorphisms found in Coffin-Lowry Syndrome.
12796492 activity is regulated by interaction with PEA-15
12792428 Postmortem fundings in the CLS syndrome are presented.
12562765 This protein is mutated in ataxia telangiectasia and is involved in the phoshphorylation of STAT3.
12054624 Molecular crosstalk between p70S6k and MAPK cell signaling pathways
11992250 Unusual splice-site mutations in the RSK2 gene and suggestion of genetic heterogeneity in Coffin-Lowry syndrome
11896450 Mutations cause X-linked Coffin-Lowry Syndrome, a mental retardation syndrome.

AA Sequence

MPLAQLADPWQKMAVESPSDSAENGQQIMDEPMGEEEINPQTEEVSIKEIAITHHVKEGHEKADPSQFEL      1 - 70
LKVLGQGSFGKVFLVKKISGSDARQLYAMKVLKKATLKVRDRVRTKMERDILVEVNHPFIVKLHYAFQTE     71 - 140
GKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALALDHLHSLGIIYRDLKPENILLDEEGHIKLT    141 - 210
DFGLSKESIDHEKKAYSFCGTVEYMAPEVVNRRGHTQSADWWSFGVLMFEMLTGTLPFQGKDRKETMTMI    211 - 280
LKAKLGMPQFLSPEAQSLLRMLFKRNPANRLGAGPDGVEEIKRHSFFSTIDWNKLYRREIHPPFKPATGR    281 - 350
PEDTFYFDPEFTAKTPKDSPGIPPSANAHQLFRGFSFVAITSDDESQAMQTVGVHSIVQQLHRNSIQFTD    351 - 420
GYEVKEDIGVGSYSVCKRCIHKATNMEFAVKIIDKSKRDPTEEIEILLRYGQHPNIITLKDVYDDGKYVY    421 - 490
VVTELMKGGELLDKILRQKFFSEREASAVLFTITKTVEYLHAQGVVHRDLKPSNILYVDESGNPESIRIC    491 - 560
DFGFAKQLRAENGLLMTPCYTANFVAPEVLKRQGYDAACDIWSLGVLLYTMLTGYTPFANGPDDTPEEIL    561 - 630
ARIGSGKFSLSGGYWNSVSDTAKDLVSKMLHVDPHQRLTAALVLRHPWIVHWDQLPQYQLNRQDAPHLVK    631 - 700
GAMAATYSALNRNQSPVLEPVGRSTLAQRRGIKKITSTAL                                  701 - 740
//

Text Mined References (146)

PMID Year Title
26977024 2016 The Clinical Implications of RSK1-3 in Human Breast Cancer.
26625210 2016 Peritoneal and hematogenous metastases of ovarian cancer cells are both controlled by the p90RSK through a self-reinforcing cell autonomous mechanism.
26354035 2015 625 kb microduplication at Xp22.12 including RPS6KA3 in a child with mild intellectual disability.
26297997 2016 Concomitant partial exon skipping by a unique missense mutation of RPS6KA3 causes Coffin-Lowry syndrome.
26158630 2015 Crucial roles of RSK in cell motility by catalysing serine phosphorylation of EphA2.
25992613 2015 MiR-191 Regulates Primary Human Fibroblast Proliferation and Directly Targets Multiple Oncogenes.
25889895 2015 Two widely used RSK inhibitors, BI-D1870 and SL0101, alter mTORC1 signaling in a RSK-independent manner.
25855080 2015 Regulation of NHE3 by lysophosphatidic acid is mediated by phosphorylation of NHE3 by RSK2.
25624005 2015 Rheumatoid arthritis. The two faces of Rsk2 in hyperplastic disease.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25044551 2014 The historical Coffin-Lowry syndrome family revisited: identification of two novel mutations of RPS6KA3 in three male patients.
25002506 2014 Phosphoproteomic analysis identifies the tumor suppressor PDCD4 as a RSK substrate negatively regulated by 14-3-3.
24719417 2014 Kaposi's sarcoma-associated herpesvirus ORF45 mediates transcriptional activation of the HIV-1 long terminal repeat via RSK2.
24416220 2014 RSK2 is a modulator of craniofacial development.
24311527 2014 Classic phenotype of Coffin-Lowry syndrome in a female with stimulus-induced drop episodes and a genotype with preserved N-terminal kinase domain.
24284076 2014 Integrins promote cytokinesis through the RSK signaling axis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24141780 2014 RSK2 regulates endocytosis of FGF receptor 1 by phosphorylation on serine 789.
24086335 2013 Ribosomal S6 Kinase 2 (RSK2) maintains genomic stability by activating the Atm/p53-dependent DNA damage pathway.
24085294 2013 The prometastatic ribosomal S6 kinase 2-cAMP response element-binding protein (RSK2-CREB) signaling pathway up-regulates the actin-binding protein fascin-1 to promote tumor metastasis.
23608533 2013 p90 RSK2 mediates antianoikis signals by both transcription-dependent and -independent mechanisms.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23541530 2013 The unusual mechanism of inhibition of the p90 ribosomal S6 kinase (RSK) by flavonol rhamnosides.
23329845 2013 Characterization of nuclear localization signal in the N terminus of integrin-linked kinase-associated phosphatase (ILKAP) and its essential role in the down-regulation of RSK2 protein signaling.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23118220 2012 RSK2 protein suppresses integrin activation and fibronectin matrix assembly and promotes cell migration.
23041051 2013 The kinase RSK2 modulates the sensitivity of ovarian cancer cells to cisplatin.
22918890 2012 RSK2 as a key regulator in human skin cancer.
22685297 2012 Tumor necrosis factor receptor-associated factor family protein 2 is a key mediator of the epidermal growth factor-induced ribosomal S6 kinase 2/cAMP-responsive element-binding protein/Fos protein signaling pathway.
22065586 2012 Oncogenic Ras and B-Raf proteins positively regulate death receptor 5 expression through co-activation of ERK and JNK signaling.
22031759 2011 Mapping the transcriptional machinery of the IL-8 gene in human bronchial epithelial cells.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21930553 2011 A child with mild X-linked intellectual disability and a microduplication at Xp22.12 including RPS6KA3.
21619683 2011 Ribosomal protein S6 kinase (RSK)-2 as a central effector molecule in RON receptor tyrosine kinase mediated epithelial to mesenchymal transition induced by macrophage-stimulating protein.
21614984 2011 A novel mutation in the RPS6KA3 gene in a patient with Coffin-Lowry syndrome.
21501342 2011 SH3P2 is a negative regulator of cell motility whose function is inhibited by ribosomal S6 kinase-mediated phosphorylation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21183680 2011 Phosphorylation of caspase-8 (Thr-263) by ribosomal S6 kinase 2 (RSK2) mediates caspase-8 ubiquitination and stability.
21061166 2010 The Coffin-Lowry syndrome-associated protein RSK2 and neurosecretion.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20385620 2010 RSK2 mediates NF-{kappa}B activity through the phosphorylation of IkappaBalpha in the TNF-R1 pathway.
20383198 2010 RSK2 is a kinetochore-associated protein that participates in the spindle assembly checkpoint.
20234090 2010 p90 ribosomal S6 kinase 2 promotes invasion and metastasis of human head and neck squamous cell carcinoma cells.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19716794 2009 RSK is a principal effector of the RAS-ERK pathway for eliciting a coordinate promotile/invasive gene program and phenotype in epithelial cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19435896 2009 A regulatory mechanism for RSK2 NH(2)-terminal kinase activity.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19150432 2009 betaTrCP- and Rsk1/2-mediated degradation of BimEL inhibits apoptosis.
19129453 2009 Mitogen-activated protein kinase-activated kinase RSK2 plays a role in innate immune responses to influenza virus infection.
18813292 2008 The RSK family of kinases: emerging roles in cellular signalling.
18775331 2008 Codependent functions of RSK2 and the apoptosis-promoting factor TIA-1 in stress granule assembly and cell survival.
18722121 2008 Oncogenic MAPK signaling stimulates mTORC1 activity by promoting RSK-mediated raptor phosphorylation.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18508509 2008 The RSK factors of activating the Ras/MAPK signaling cascade.
18402937 2008 Anti-apoptotic actions of vasopressin in H32 neurons involve MAP kinase transactivation and Bad phosphorylation.
18156174 2008 Epidermal growth factor stimulates RSK2 activation through activation of the MEK/ERK pathway and src-dependent tyrosine phosphorylation of RSK2 at Tyr-529.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17938253 2008 Critical role for Rsk2 in T-lymphocyte activation.
17360704 2007 RAS/ERK signaling promotes site-specific ribosomal protein S6 phosphorylation via RSK and stimulates cap-dependent translation.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17318637 2007 Altered neurodevelopment associated with mutations of RSK2: a morphometric MRI study of Coffin-Lowry syndrome.
17225856 2007 Recruitment and activation of RSK2 by HIV-1 Tat.
17213202 2007 RSK2 mediates muscle cell differentiation through regulation of NFAT3.
17192257 2007 Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry.
17100996 2006 Mutations in the RSK2(RPS6KA3) gene cause Coffin-Lowry syndrome and nonsyndromic X-linked mental retardation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16879200 2006 Identification of novel mutations in the RSK2 gene (RPS6KA3) in patients with Coffin-Lowry syndrome.
16691578 2006 A novel RSK2 (RPS6KA3) gene mutation associated with abnormal brain MRI findings in a family with Coffin-Lowry syndrome.
16626623 2006 The MAP kinase ERK5 binds to and phosphorylates p90 RSK.
16537434 2006 p90 ribosomal S6 kinase 2 exerts a tonic brake on G protein-coupled receptor signaling.
16223362 2006 Nur77 is phosphorylated in cells by RSK in response to mitogenic stimulation.
16213824 2005 The tumor suppressor DAP kinase is a target of RSK-mediated survival signaling.
15879597 2005 Exogenously added fibroblast growth factor 2 (FGF-2) to NIH3T3 cells interacts with nuclear ribosomal S6 kinase 2 (RSK2) in a cell cycle-dependent manner.
15833840 2005 The serine/threonine protein kinase, p90 ribosomal S6 kinase, is an important regulator of prostate cancer cell proliferation.
15772651 2005 The DNA sequence of the human X chromosome.
15515167 2004 Kinetic analysis of RSK2 and Elk-1 interaction on the serum response element and implications for cellular engineering.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15276183 2004 MD-2: the Toll 'gatekeeper' in endotoxin signalling.
15214012 2004 Cardiomyopathy in Coffin-Lowry syndrome.
15109498 2004 ATF4 is a substrate of RSK2 and an essential regulator of osteoblast biology; implication for Coffin-Lowry Syndrome.
14986828 2003 Intronic L1 insertion and F268S, novel mutations in RPS6KA3 (RSK2) causing Coffin-Lowry syndrome.
14973203 2004 Delineation of the mechanisms of aberrant splicing caused by two unusual intronic mutations in the RSK2 gene involved in Coffin-Lowry syndrome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14678837 2004 Expression of the RSK2 gene during early human development.
12832467 2003 Phosphorylation of p90 ribosomal S6 kinase (RSK) regulates extracellular signal-regulated kinase docking and RSK activity.
12796492 2003 RSK2 activity is regulated by its interaction with PEA-15.
12792428 Postmortem findings in the Coffin-Lowry Syndrome.
12777533 2003 Gene diversity patterns at 10 X-chromosomal loci in humans and chimpanzees.
12773393 2003 MSK2 and MSK1 mediate the mitogen- and stress-induced phosphorylation of histone H3 and HMG-14.
12601080 2003 Signaling initiated by overexpression of the fibroblast growth factor receptor-1 investigated by mass spectrometry.
12562765 2003 Ataxia telangiectasia mutated proteins, MAPKs, and RSK2 are involved in the phosphorylation of STAT3.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12439904 2002 Coffin-Lowry syndrome in a patient from the Cook Islands confirmed by the presence of a unique mutation.
12393804 2002 Expression analysis of RSK gene family members: the RSK2 gene, mutated in Coffin-Lowry syndrome, is prominently expressed in brain structures essential for cognitive function and learning.
12387894 2002 Involvement of aberrant glycosylation in phosphorylation of tau by cdk5 and GSK-3beta.
12054624 2002 Molecular crosstalk between p70S6k and MAPK cell signaling pathways.
11992250 2002 Unusual splice-site mutations in the RSK2 gene and suggestion of genetic heterogeneity in Coffin-Lowry syndrome.
11896450 2002 X-linked Coffin-Lowry syndrome (CLS, MIM 303600, RPS6KA3 gene, protein product known under various names: pp90(rsk2), RSK2, ISPK, MAPKAP1).
11853558 2002 Identification and characterization of four novel phosphorylation sites (Ser31, Ser325, Thr336 and Thr366) on LKB1/STK11, the protein kinase mutated in Peutz-Jeghers cancer syndrome.
11752456 2001 Insight into hepatocellular carcinogenesis at transcriptome level by comparing gene expression profiles of hepatocellular carcinoma with those of corresponding noncancerous liver.
11564891 2001 Mitogen-regulated RSK2-CBP interaction controls their kinase and acetylase activities.
11544290 2001 Diverse transcriptional response of CD4+ T cells to stromal cell-derived factor SDF-1: cell survival promotion and priming effects of SDF-1 on CD4+ T cells.
11507039 2001 Phosphatidylinositol-3-OH Kinase (PI3K)/AKT2, activated in breast cancer, regulates and is induced by estrogen receptor alpha (ERalpha) via interaction between ERalpha and PI3K.
11495723 2001 MEK, ERK, and p90RSK are present on mitotic tubulin in Swiss 3T3 cells: a role for the MAP kinase pathway in regulating mitotic exit.
11438671 2001 Mitotic phosphorylation prevents the binding of HMGN proteins to chromatin.
11432835 2001 Rsk2 allosterically activates estrogen receptor alpha by docking to the hormone-binding domain.
11311121 2001 The kinase DYRK phosphorylates protein-synthesis initiation factor eIF2Bepsilon at Ser539 and the microtubule-associated protein tau at Thr212: potential role for DYRK as a glycogen synthase kinase 3-priming kinase.
11297520 2001 Phosphorylation of the protein kinase mutated in Peutz-Jeghers cancer syndrome, LKB1/STK11, at Ser431 by p90(RSK) and cAMP-dependent protein kinase, but not its farnesylation at Cys(433), is essential for LKB1 to suppress cell vrowth.
11181841 2001 Characterization of the in vitro phosphorylation of human tau by tau protein kinase II (cdk5/p20) using mass spectrometry.
11175347 2000 NO activation of fos promoter elements requires nuclear translocation of G-kinase I and CREB phosphorylation but is independent of MAP kinase activation.
11160957 2001 Cognitive impairment in Coffin-Lowry syndrome correlates with reduced RSK2 activation.
11139588 2001 Phosphatidylinositol 3-kinase/AKT-mediated activation of estrogen receptor alpha: a new model for anti-estrogen resistance.
10862698 2000 Proteomic analysis of NMDA receptor-adhesion protein signaling complexes.
10856237 2000 A phosphoserine-regulated docking site in the protein kinase RSK2 that recruits and activates PDK1.
10739259 2000 Phosphorylation and subcellular redistribution of high mobility group proteins 14 and 17, analyzed by mass spectrometry.
10528858 1999 Unreported RSK2 missense mutation in two male sibs with an unusually mild form of Coffin-Lowry syndrome.
10480933 1999 90-kDa ribosomal S6 kinase is phosphorylated and activated by 3-phosphoinositide-dependent protein kinase-1.
10436156 1999 Requirement of Rsk-2 for epidermal growth factor-activated phosphorylation of histone H3.
10319851 1999 A missense mutation in RPS6KA3 (RSK2) responsible for non-specific mental retardation.
10094187 1999 Novel mutations in Rsk-2, the gene for Coffin-Lowry syndrome (CLS).
9915826 1999 Identification of an extracellular signal-regulated kinase (ERK) docking site in ribosomal S6 kinase, a sequence critical for activation by ERK in vivo.
9887375 Germline mosaicism in Coffin-Lowry syndrome.
9837815 1998 Mutation analysis of the RSK2 gene in Coffin-Lowry patients: extensive allelic heterogeneity and a high rate of de novo mutations.
9832145 1998 New phosphorylation sites identified in hyperphosphorylated tau (paired helical filament-tau) from Alzheimer's disease brain using nanoelectrospray mass spectrometry.
9829964 1998 CREB is a regulatory target for the protein kinase Akt/PKB.
9770464 1998 Rsk-2 activity is necessary for epidermal growth factor-induced phosphorylation of CREB protein and transcription of c-fos gene.
9687510 1998 Mitogen- and stress-activated protein kinase-1 (MSK1) is directly activated by MAPK and SAPK2/p38, and may mediate activation of CREB.
9546672 1998 Sequential phosphorylation of Tau by glycogen synthase kinase-3beta and protein kinase A at Thr212 and Ser214 generates the Alzheimer-specific epitope of antibody AT100 and requires a paired-helical-filament-like conformation.
9528769 1998 pp90rsk1 regulates estrogen receptor-mediated transcription through phosphorylation of Ser-167.
9353289 1997 Phosphorylation by neuronal cdc2-like protein kinase promotes dimerization of Tau protein in vitro.
8955270 1996 Mutations in the kinase Rsk-2 associated with Coffin-Lowry syndrome.
8688081 1996 Coupling of the RAS-MAPK pathway to gene activation by RSK2, a growth factor-regulated CREB kinase.
8250835 1993 Inactivation of glycogen synthase kinase-3 beta by phosphorylation: new kinase connections in insulin and growth-factor signalling.
8141249 1994 Human rsk isoforms: cloning and characterization of tissue-specific expression.
7943043 1994 Regional localisation of a non-specific X-linked mental retardation gene (MRX19) to Xp22.
7813820 1995 Cloning of a human insulin-stimulated protein kinase (ISPK-1) gene and analysis of coding regions and mRNA levels of the ISPK-1 and the protein phosphatase-1 genes in muscle from NIDDM patients.
7623830 1995 RSK3 encodes a novel pp90rsk isoform with a unique N-terminal sequence: growth factor-stimulated kinase function and nuclear translocation.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.
7523419 1994 Identification of the major physiologic phosphorylation site of human keratin 18: potential kinases and a role in filament reorganization.
1374067 1992 PKC epsilon-related kinase associates with and phosphorylates cytokeratin 8 and 18.