Property Summary

NCBI Gene PubMed Count 55
PubMed Score 136.66
PubTator Score 114.28

Knowledge Summary

Patent (29,163)


  Differential Expression (16)

Disease log2 FC p
active Crohn's disease 1.893 5.9e-04
active ulcerative colitis 2.652 6.2e-04
astrocytic glioma -1.700 1.1e-02
atypical teratoid / rhabdoid tumor -1.100 3.5e-04
group 3 medulloblastoma -1.200 3.1e-02
intraductal papillary-mucinous neoplasm ... -1.400 1.8e-02
lung cancer -2.900 1.7e-05
lung carcinoma -1.600 1.4e-19
malignant mesothelioma -2.500 1.2e-07
medulloblastoma, large-cell -1.700 7.4e-06
non-small cell lung cancer -1.460 2.4e-15
osteosarcoma 1.255 6.9e-05
ovarian cancer 1.100 1.6e-10
pituitary cancer -1.300 2.1e-04
posterior fossa group B ependymoma -1.100 2.2e-07
subependymal giant cell astrocytoma -1.017 3.3e-02

Gene RIF (17)

AA Sequence

ALNRTPQAPRLEPVLSSNLAQRRGMKRLTSTRL                                         701 - 733

Text Mined References (59)

PMID Year Title