1. Home
  2. Targets
  3. nucleic acid binding
  4. RNA binding protein
  5. ribosomal protein
  6. 40S ribosomal protein S5

Tbio 40S ribosomal protein S5

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S7P family of ribosomal proteins. It is located in the cytoplasm. Variable expression of this gene in colorectal cancers compared to adjacent normal tissues has been observed, although no correlation between the level of expression and the severity of the disease has been found. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq, Jul 2008]

 Comments

Property Summary

NCBI Gene PubMed Count 30
PubMed Score 174.70
PubTator Score 31.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (11)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 6.1e-06
medulloblastoma 1.300 7.7e-05
medulloblastoma, large-cell 1.700 3.1e-05
intraductal papillary-mucinous adenoma (... -1.200 2.3e-03
intraductal papillary-mucinous neoplasm ... -1.800 7.8e-04
lung cancer 1.600 4.2e-05
diabetes mellitus -1.100 2.2e-03
inflammatory breast cancer -1.400 4.8e-03
mucosa-associated lymphoid tissue lympho... -1.219 3.6e-02
acute myeloid leukemia 2.000 2.4e-02
ovarian cancer -1.500 4.0e-05

Synonym

Accession P46782 B2R4T2 Q96BN0
Symbols S5

Gene

RPS5

PANTHER Protein Class (3)

PDB

4UG0   4V6X   5AJ0   5A2Q   5FLX  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 UniProt Keyword (8)

 GO Function (5)

 GO Component (8)

 GO Process (8)

 Compartment GO Term (49)

See all...

 HCA RNA Cell Line (56)

See all...

Pathway (36)

See all...

Protein-protein Interaction (105)

EIF3F   EIF3D   EIF3H   EIF3G   EIF3J   EIF2S1   RPLP1   RPLP2   RPLP0   EIF4E   RPSA   RPL35A   RPL7   RPL17   EIF2S2   EIF4B   RPL13   RPL10   RPL12   RPL9   RPL22   RPL4   RPL3   RPL13A   EIF2S3   RPL35   SSR1   RPL27A   RPL5   RPL21   RPL28   RPS9   EIF1AX   RPL29   RPL34   EIF2B2   RPL14   EIF5   EIF3B   SEC61G   EIF3E   EIF4A1   SPCS3   RPL26   RPL15   RPL27   RPL37A   RPL37   RPS7   RPS8   RPL7A   RPL23A   RPS6   RPL23   RPL30   RPL39   RPL31   RPL10A   RPL32   RPL11   RPL8   RPL41   UBA52   RPL38   RPL24   RPL36A   RPL19   RPL18A   RPL6   EIF4G1   RPL18   EIF2B5   EIF3I   EIF3A   EIF2B1   EIF4A2   EIF4H   RNPS1   TSR1   EIF3M   SMG6   GSPT2   SMG8   MAGOHB   LTV1   ERO1A   SMG1   EIF3C   RIOK1   RPP25   RIOK2   UPF3B   SMG9   UPF3A   RPP21   UPF2   EIF2B3   PNO1   EIF3K   SRP68   EIF2B4   TRMT112   NOB1   SMG5   RPL36  

Gene RIF (5)

PMID Text
26362536 HIV-1 Gag interacts with RPS5 as demonstrated by proximity dependent biotinylation proteomics
25712089 Data indicate that beta hairpin structure present in ribosomal protein S5 (RPS5) is important for IRES-RPS5 interaction.
22174317 HIV-1 Gag interacts with RPS5 as demonstrated by proximity dependent biotinylation proteomics
19807034 Mutual effect of human ribosomal proteins S5 and S16 on their binding with 18S rRNA fragment 1203-1236/1521-1698
17901157 Transfected into yeast cells, plays an important role in maintaining the accuracy of translation.

AA Sequence 

MTEWETAAPAVAETPDIKLFGKWSTDDVQINDISLQDYIAVKEKYAKYLPHSAGRYAAKRFRKAQCPIVE      1 - 70
RLTNSMMMHGRNNGKKLMTVRIVKHAFEIIHLLTGENPLQVLVNAIINSGPREDSTRIGRAGTVRRQAVD     71 - 140
VSPLRRVNQAIWLLCTGAREAAFRNIKTIAECLADELINAAKGSSNSYAIKKKDELERVAKSNR          141 - 204
//

Text Mined References (39)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25712089 2015 The beta hairpin structure within ribosomal protein S5 mediates interplay between domains II and IV and regulates HCV IRES function.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21269460 2011 Initial characterization of the human central proteome.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19946888 2010 Defining the membrane proteome of NK cells.
19807034 [Mutual effect of human ribosomal proteins S5 and S16 on their binding with 18S rRNA fragment 1203-1236/1521-1698].
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18809582 2008 Nucleophosmin serves as a rate-limiting nuclear export chaperone for the Mammalian ribosome.
18464793 2008 Ribosomal position and contacts of mRNA in eukaryotic translation initiation complexes.
17901157 2007 Roles of the negatively charged N-terminal extension of Saccharomyces cerevisiae ribosomal protein S5 revealed by characterization of a yeast strain containing human ribosomal protein S5.
15883184 2005 Mass spectrometric analysis of the human 40S ribosomal subunit: native and HCV IRES-bound complexes.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15189156 2004 The molecular mechanics of eukaryotic translation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12651107 2003 Expression and purification of human ribosomal proteins S3, S5, S10, S19, and S26.
12588972 2003 Transcript-selective translational silencing by gamma interferon is directed by a novel structural element in the ceruloplasmin mRNA 3' untranslated region.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11875025 2002 The human ribosomal protein genes: sequencing and comparative analysis of 73 genes.
11790298 2002 Directed proteomic analysis of the human nucleolus.
11751223 2001 Differential expression of genes coding for ribosomal proteins in different human tissues.
9582194 1998 A map of 75 human ribosomal protein genes.
8722009 Structure and evolution of mammalian ribosomal proteins.
8706699 1996 Characterization of the human small-ribosomal-subunit proteins by N-terminal and internal sequencing, and mass spectrometry.
8318536 1993 Structural arrangement of the codon-anticodon interaction area in human placenta ribosomes. Affinity labelling of the 40S subunits by derivatives of oligoribonucleotides containing the AUG codon.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7821789 1994 Construction of a human full-length cDNA bank.
7772601 1995 Cloning, sequencing and expression of the L5, L21, L27a, L28, S5, S9, S10 and S29 human ribosomal protein mRNAs.