Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.36
PubTator Score 2.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Gene RIF (1)

PMID Text
20459660 One of the Y-linked copies of the ribosomal protein S4 is expressed during spermatogenesis and germ cell development and the C-terminus of the protein has some degree of functional specialisation of this protein in spermatogenesis.

AA Sequence

MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIVFLRNRLKYALTGDEVKKICMQHFL      1 - 70
KIDGKVRVDITYPAGFIDVISIEKTGEHFRLVYNTKGCFAVHRITVEEAKYKLCKVRKITVGTKGIPHLV     71 - 140
THDARTIRYPDPLIKVNDTVQIDLGTGKITSFIKFDTGNVCMVIAGANLGRVGVITNRERHPGSCDVVHV    141 - 210
KDANGNSFATRISNIFVIGNGNKPWISLPRGKGIRLTIAEERDKRLAAKQSSG                     211 - 263
//

Text Mined References (3)

PMID Year Title
22708584 2012 Primer-BLAST: a tool to design target-specific primers for polymerase chain reaction.
20459660 2010 The human RPS4 paralogue on Yq11.223 encodes a structurally conserved ribosomal protein and is preferentially expressed during spermatogenesis.
12815422 2003 The male-specific region of the human Y chromosome is a mosaic of discrete sequence classes.