Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.36
PubTator Score 2.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Spermatogenic Failure, Nonobstructive, Y-Linked 15 0.0 0.0
Disease Target Count Z-score Confidence
Sertoli cell-only syndrome 37 4.295 2.1
Azoospermia 110 4.21 2.1

Gene RIF (1)

AA Sequence

MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIVFLRNRLKYALTGDEVKKICMQHFL      1 - 70
KIDGKVRVDITYPAGFIDVISIEKTGEHFRLVYNTKGCFAVHRITVEEAKYKLCKVRKITVGTKGIPHLV     71 - 140
THDARTIRYPDPLIKVNDTVQIDLGTGKITSFIKFDTGNVCMVIAGANLGRVGVITNRERHPGSCDVVHV    141 - 210
KDANGNSFATRISNIFVIGNGNKPWISLPRGKGIRLTIAEERDKRLAAKQSSG                     211 - 263
//

Text Mined References (4)

PMID Year Title