Property Summary

NCBI Gene PubMed Count 35
PubMed Score 34.61
PubTator Score 123.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Mammary Neoplasms 410
Disease Target Count P-value
ovarian cancer 8491 1.7e-04
lung cancer 4473 3.8e-02
Disease Target Count Z-score Confidence
Turner syndrome 31 4.977 2.5
Glycogen storage disease I 2 3.071 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer -4.100 3.8e-02
ovarian cancer -1.300 1.7e-04

Gene RIF (5)

PMID Text
25731206 Low RPS4X expression is associated with poor disease-specific and recurrence-free survival in bladder cancer
24503063 The 3'-UTR of liver mRNA of galectin-1 and RPS4X bind to the HCV NS5B.
23800275 levels of RPS4X could be a good indicator for resistance to platinum-based therapy and a prognostic marker for ovarian cancer
23125841 Tandem affinity purification and mass spectrometry analysis identify X-linked isoform of ribosomal protein S4 (RPS4X), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22174317 Tandem affinity purification and mass spectrometry analysis identify X-linked isoform of ribosomal protein S4 (RPS4X), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells

AA Sequence

MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIIFLRNRLKYALTGDEVKKICMQRFI      1 - 70
KIDGKVRTDITYPAGFMDVISIDKTGENFRLIYDTKGRFAVHRITPEEAKYKLCKVRKIFVGTKGIPHLV     71 - 140
THDARTIRYPDPLIKVNDTIQIDLETGKITDFIKFDTGNLCMVTGGANLGRIGVITNRERHPGSFDVVHV    141 - 210
KDANGNSFATRLSNIFVIGKGNKPWISLPRGKGIRLTIAEERDKRLAAKQSSG                     211 - 263
//

Text Mined References (39)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25731206 2015 Low level of the X-linked ribosomal protein S4 in human urothelial carcinomas is associated with a poor prognosis.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24503063 2014 In vitro selection of the 3'-untranslated regions of the human liver mRNA that bind to the HCV nonstructural protein 5B.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23800275 2013 Low expression of the X-linked ribosomal protein S4 in human serous epithelial ovarian cancer is associated with a poor prognosis.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21269460 2011 Initial characterization of the human central proteome.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19946888 2010 Defining the membrane proteome of NK cells.
17289661 2007 Molecular composition of IMP1 ribonucleoprotein granules.
15883184 2005 Mass spectrometric analysis of the human 40S ribosomal subunit: native and HCV IRES-bound complexes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15189156 2004 The molecular mechanics of eukaryotic translation.
15121898 2004 The composition of Staufen-containing RNA granules from human cells indicates their role in the regulated transport and translation of messenger RNAs.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14660691 2004 Sex differences in structure and expression of the sex chromosome genes CHD1Z and CHD1W in zebra finches.
12588972 2003 Transcript-selective translational silencing by gamma interferon is directed by a novel structural element in the ceruloplasmin mRNA 3' untranslated region.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11790298 2002 Directed proteomic analysis of the human nucleolus.
11721045 2001 Crystal structure of Arp2/3 complex.
11401437 2001 A complete map of the human ribosomal protein genes: assignment of 80 genes to the cytogenetic map and implications for human disorders.
9582194 1998 A map of 75 human ribosomal protein genes.
8808278 1996 Relationship between the monosomy X phenotype and Y-linked ribosomal protein S4 (Rps4) in several species of mammals: a molecular evolutionary analysis of Rps4 homologs.
8722009 Structure and evolution of mammalian ribosomal proteins.
8706699 1996 Characterization of the human small-ribosomal-subunit proteins by N-terminal and internal sequencing, and mass spectrometry.
8557258 1996 Ullrich-Turner syndrome is not caused by haploinsufficiency of RPS4X.
8358435 1993 Functional equivalence of human X- and Y-encoded isoforms of ribosomal protein S4 consistent with a role in Turner syndrome.
8139551 1994 Structure and function of ribosomal protein S4 genes on the human and mouse sex chromosomes.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
8076819 1994 The addition of 5'-coding information to a 3'-directed cDNA library improves analysis of gene expression.
2829364 1988 Isolation of an abundantly expressed sequence from the human X chromosome by differential screening.
2124517 1990 Homologous ribosomal protein genes on the human X and Y chromosomes: escape from X inactivation and possible implications for Turner syndrome.
1795030 1991 Molecular cloning of the human gene, CCG2, that complements the BHK-derived temperature-sensitive cell cycle mutant tsBN63: identity of CCG2 with the human X chromosomal SCAR/RPS4X gene.