Property Summary

NCBI Gene PubMed Count 84
PubMed Score 157.72
PubTator Score 142.48

Knowledge Summary


No data available


  Differential Expression (8)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 2.4e-06
diabetes mellitus -1.400 1.6e-03
lung cancer 1.200 1.1e-03
medulloblastoma, large-cell 1.600 3.6e-05
Multiple myeloma 1.268 1.3e-03
Pick disease 1.100 3.4e-07
sonic hedgehog group medulloblastoma 1.400 1.6e-06
Waldenstrons macroglobulinemia 1.105 1.1e-02


Accession P23396 B2R7N5 J3KN86 Q498B5 Q8NI95
Symbols S3


PDB (10)

Gene RIF (33)

AA Sequence

VEPKDEILPTTPISEQKGGKPEPPAMPQPVPTA                                         211 - 243

Text Mined References (107)

PMID Year Title