Property Summary

NCBI Gene PubMed Count 40
PubMed Score 37.08
PubTator Score 32.94

Knowledge Summary

Patent

No data available

Expression

Gene RIF (7)

AA Sequence

MTKKRRNNGRAKKGRGHVQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDISEASVFDAYVLPKLYVK      1 - 70
LHYCVSCAIHSKVVRNRSREARKDRTPPPRFRPAGAAPRPPPKPM                              71 - 115
//

Text Mined References (44)

PMID Year Title