Property Summary

NCBI Gene PubMed Count 29
PubMed Score 45.77
PubTator Score 26.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
acute myeloid leukemia 785 1.2e-02
Disease Target Count Z-score Confidence
Lafora disease 9 3.669 1.8
Diamond-Blackfan anemia 30 3.316 1.7

Expression

  Differential Expression (1)

Disease log2 FC p
acute myeloid leukemia 1.800 1.2e-02

Gene RIF (2)

PMID Text
22777350 data demonstrate that ribosomal protein S25 is a novel regulator of the MDM2-p53 circuit in ribosomal stress; results shed light on biological consequences of RP-MDM2-p53 interplay and also reveal the existence of a novel S25-p53 feedback regulatory loop
22174317 HIV-1 Rev interacting protein, ribosomal protein S25 (RPS25), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells

AA Sequence

MPPKDDKKKKDAGKSAKKDKDPVNKSGGKAKKKKWSKGKVRDKLNNLVLFDKATYDKLCKEVPNYKLITP      1 - 70
AVVSERLKIRGSLARAALQELLSKGLIKLVSKHRAQVIYTRNTKGGDAPAAGEDA                    71 - 125
//

Text Mined References (34)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22777350 2013 Identification of ribosomal protein S25 (RPS25)-MDM2-p53 regulatory feedback loop.
22720776 2012 PHF6 interacts with the nucleosome remodeling and deacetylation (NuRD) complex.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21269460 2011 Initial characterization of the human central proteome.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15883184 2005 Mass spectrometric analysis of the human 40S ribosomal subunit: native and HCV IRES-bound complexes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231747 2004 A protein interaction framework for human mRNA degradation.
15189156 2004 The molecular mechanics of eukaryotic translation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12588972 2003 Transcript-selective translational silencing by gamma interferon is directed by a novel structural element in the ceruloplasmin mRNA 3' untranslated region.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11875025 2002 The human ribosomal protein genes: sequencing and comparative analysis of 73 genes.
11101529 2000 Functional analysis of the human CDC5L complex and identification of its components by mass spectrometry.
10050887 1999 Nuclear and nucleolar targeting of human ribosomal protein S25: common features shared with HIV-1 regulatory proteins.
9582194 1998 A map of 75 human ribosomal protein genes.
8722009 Structure and evolution of mammalian ribosomal proteins.
8706699 1996 Characterization of the human small-ribosomal-subunit proteins by N-terminal and internal sequencing, and mass spectrometry.
8406452 1993 Fifty sequenced-tagged sites on human chromosome 11.
8020948 1994 Assignment of the human ribosomal protein S25 gene (RPS25) to chromosome 11q23.3 by sequence analysis of the marker D11S456.
7821789 1994 Construction of a human full-length cDNA bank.
3378620 1988 Ribosomal proteins S2, S6, S10, S14, S15 and S25 are localized on the surface of mammalian 40 S subunits and stabilize their conformation. A study with immobilized trypsin.
1748303 1991 Cloning and sequencing a cDNA encoding human ribosomal protein S25.
1544436 1992 Regulation of ribosomal protein S25 in HL60 cells isolated for resistance to adriamycin.