Property Summary

NCBI Gene PubMed Count 33
PubMed Score 74.65
PubTator Score 64.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma 1.800 7.1e-06
cutaneous lupus erythematosus -1.200 4.6e-02
psoriasis -3.500 4.6e-06
atypical teratoid / rhabdoid tumor -1.400 4.8e-03
glioblastoma -1.100 1.0e-02
lung cancer 1.100 6.0e-04
cystic fibrosis -1.300 1.5e-04
aldosterone-producing adenoma -1.055 7.2e-03
Breast cancer -1.100 2.1e-08
ovarian cancer -1.100 4.1e-05

Gene RIF (6)

PMID Text
26506620 increased expression of RPS11 and RPS20 predicts shorter patient survival. treatment-resistant GSC clones are clinically relevant cells that represent resistant tumorigenic clones from patient tumors and that their properties
24941021 Mutations in RPS20 can predispose individuals to microsatellite-stable hereditary nonpolyposis colorectal carcinoma.
23874713 RPL37, RPS15 and RPS20 regulate the Mdm2-p53-MdmX network but employ different mechanisms to do so.
22534017 HIV-1 Nef immunocomplexes analyzed by mass spectrometry reveal that ribosomal protein S20 (RPS20) is a Nef-binding protein in Jurkat cells
20546612 Observational study of gene-disease association. (HuGE Navigator)
16968546 Gain of 8q-mapped RPS20 is associated with adverse outcome in Medulloblastoma.

AA Sequence

MAFKDTGKTPVEPEVAIHRIRITLTSRNVKSLEKVCADLIRGAKEKNLKVKGPVRMPTKTLRITTRKTPC      1 - 70
GEGSKTWDRFQMRIHKRLIDLHSPSEIVKQITSISIEPGVEVEVTIADA                          71 - 119
//

Text Mined References (41)

PMID Year Title
26506620 2015 Ribosomal Proteins RPS11 and RPS20, Two Stress-Response Markers of Glioblastoma Stem Cells, Are Novel Predictors of Poor Prognosis in Glioblastoma Patients.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24947832 2014 Differential protein-protein interactions of LRRK1 and LRRK2 indicate roles in distinct cellular signaling pathways.
24941021 2014 Germline mutation of RPS20, encoding a ribosomal protein, causes predisposition to hereditary nonpolyposis colorectal carcinoma without DNA mismatch repair deficiency.
24725412 2014 Ribosomal protein s15 phosphorylation mediates LRRK2 neurodegeneration in Parkinson's disease.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23874713 2013 Ribosomal proteins RPL37, RPS15 and RPS20 regulate the Mdm2-p53-MdmX network.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
18391951 2008 Many sequence variants affecting diversity of adult human height.
18274552 2008 Ribosomal proteins are targets for the NEDD8 pathway.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17373842 2007 HDM2-binding partners: interaction with translation elongation factor EF1alpha.
17220478 2007 Proteomics analysis of the interactome of N-myc downstream regulated gene 1 and its interactions with the androgen response program in prostate cancer cells.
16968546 2006 Medulloblastoma outcome is adversely associated with overexpression of EEF1D, RPL30, and RPS20 on the long arm of chromosome 8.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15883184 2005 Mass spectrometric analysis of the human 40S ribosomal subunit: native and HCV IRES-bound complexes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231747 2004 A protein interaction framework for human mRNA degradation.
15189156 2004 The molecular mechanics of eukaryotic translation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12588972 2003 Transcript-selective translational silencing by gamma interferon is directed by a novel structural element in the ceruloplasmin mRNA 3' untranslated region.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107412 2002 Expressed sequence tag analysis of adult human iris for the NEIBank Project: steroid-response factors and similarities with retinal pigment epithelium.
11875025 2002 The human ribosomal protein genes: sequencing and comparative analysis of 73 genes.
9582194 1998 A map of 75 human ribosomal protein genes.
8722009 Structure and evolution of mammalian ribosomal proteins.
8706699 1996 Characterization of the human small-ribosomal-subunit proteins by N-terminal and internal sequencing, and mass spectrometry.
8674114 1996 Site-specific ribose methylation of preribosomal RNA: a novel function for small nucleolar RNAs.
8479924 1993 Human ribosomal protein S20 cDNA sequence.
7821789 1994 Construction of a human full-length cDNA bank.