Property Summary

NCBI Gene PubMed Count 17
PubMed Score 49.46
PubTator Score 9.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (1)

Disease log2 FC p
glioblastoma -1.100 7.2e-04

Protein-protein Interaction (9)

Gene RIF (6)

AA Sequence

MSAALLRRGLELLAASEAPRDPPGQAKPRGAPVKRPRKTKAIQAQKLRNSAKGKVPKSALDEYRKRECRD      1 - 70
HLRVNLKFLTRTRSTVAESVSQQILRQNRGRKACDRPVAKTKKKKAEGTVFTEEDFQKFQQEYFGS         71 - 136
//

Text Mined References (20)

PMID Year Title