Property Summary

NCBI Gene PubMed Count 17
PubMed Score 46.17
PubTator Score 9.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
glioblastoma 5572 7.2e-04
Disease Target Count Z-score Confidence
Severe acute respiratory syndrome 26 3.359 1.7
Osteopetrosis 40 3.165 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
glioblastoma -1.100 7.2e-04

Synonym

Accession Q86WX3 B0QY96 Q5JZA1
Symbols AROS
S19BP

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (9)

Gene RIF (6)

PMID Text
26339164 AROS is a significant biomarker for tumor aggressiveness in non-cirrhotic hepatocellular carcinoma.
24681097 In vitro SIRT1 activity assays disclose AROS as an inhibitor of SIRT1.
24258275 study demonstrated a cancer-specific role for AROS in the regulation of survival in a panel of human cell lines; data suggest that AROS, as well as SIRT1, promotes survival in cancer cells while being redundant for viability in non-cancer cells
23548308 This study analyses Sirt1 modulation by several putative Sirt1 regulators, showing that the regulator protein AROS has an unusual conformation and that the Sirt1 catalytic domain is sufficient for modulation by resveratrol.
23349863 we found that the SIRT1 modulators AROS and DBC1 have an impact on hsp70 transcription, HSF1 acetylation status, and HSF1 recruitment to the hsp70 promoter.
17964266 Active regulator of SIRT1 (AROS) is the first direct SIRT1 regulator to be identified that modulates p53-mediated growth regulation.

AA Sequence

MSAALLRRGLELLAASEAPRDPPGQAKPRGAPVKRPRKTKAIQAQKLRNSAKGKVPKSALDEYRKRECRD      1 - 70
HLRVNLKFLTRTRSTVAESVSQQILRQNRGRKACDRPVAKTKKKKAEGTVFTEEDFQKFQQEYFGS         71 - 136
//

Text Mined References (20)

PMID Year Title
26339164 2015 AROS Is a Significant Biomarker for Tumor Aggressiveness in Non-cirrhotic Hepatocellular Carcinoma.
25416956 2014 A proteome-scale map of the human interactome network.
24681097 2014 AROS has a context-dependent effect on SIRT1.
24258275 2013 Active regulator of SIRT1 is required for cancer cell survival but not for SIRT1 activity.
23548308 2013 Molecular architecture of the human protein deacetylase Sirt1 and its regulation by AROS and resveratrol.
23382074 2013 A high-confidence interaction map identifies SIRT1 as a mediator of acetylation of USP22 and the SAGA coactivator complex.
23349863 2013 The SIRT1 modulators AROS and DBC1 regulate HSF1 activity and the heat shock response.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17964266 2007 Active regulator of SIRT1 cooperates with SIRT1 and facilitates suppression of p53 activity.
16289379 2006 A novel nucleolar protein interacts with ribosomal protein S19.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591208 1999 The DNA sequence of human chromosome 22.