Property Summary

NCBI Gene PubMed Count 42
PubMed Score 0.00
PubTator Score 39.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell 1.200 2.3e-06
lung cancer -4.000 2.2e-02
ovarian cancer -1.100 1.0e-03

Gene RIF (8)

PMID Text
25853866 Nuclear and nucleolar localization signals within the human ribosomal protein S17 have been mapped.
22944692 HIV-1 Rev interacting protein, ribosomal protein S17 (RPS17), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
22398290 Human S17 insertion was a major factor for hepatitis E virus in cell culture adaptation.
22262766 Data show 1 proband with an RPL5 deletion, 1 patient with an RPL35A deletion, 3 with RPS17 deletions, and 1 with an RPS19 deletion.
22174317 HIV-1 Rev interacting protein, ribosomal protein S17 (RPS17), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
22045982 Studies identified deletions at known Diamond-Blackfan anemia (DBA)-related ribosomal protein gene loci in 17% (9 of 51) of patients without an identifiable mutation, including RPS19, RPS17, RPS26, and RPL35A.
20378560 Observational study of gene-disease association. (HuGE Navigator)
17647292 Data show in Diamond-Blackfan anemia, mutation in RPS17 wasn detected and the mutation affects the translation initiation start codon, changing T to G (c.2T>G), thus eliminating the natural start of RPS17 protein biosynthesis

AA Sequence

MGRVRTKTVKKAARVIIEKYYTRLGNDFHTNKRVCEEIAIIPSKKLRNKIAGYVTHLMKRIQRGPVRGIS      1 - 70
IKLQEEERERRDNYVPEVSALDQEIIEVDPDTKEMLKLLDFGSLSNLQVTQPTVGMNFKTPRGPV          71 - 135
//

Text Mined References (46)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25853866 2015 Identification and fine mapping of nuclear and nucleolar localization signals within the human ribosomal protein S17.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24675553 2014 Ribosomal protein mutations in Korean patients with Diamond-Blackfan anemia.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22398290 2012 Adaptation of a genotype 3 hepatitis E virus to efficient growth in cell culture depends on an inserted human gene segment acquired by recombination.
22262766 2012 Extensive gene deletions in Japanese patients with Diamond-Blackfan anemia.
22045982 2011 Ribosomal protein gene deletions in Diamond-Blackfan anemia.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20378560 2010 Mutations in the ribosomal protein genes in Japanese patients with Diamond-Blackfan anemia.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19061985 2008 Ribosomal protein L5 and L11 mutations are associated with cleft palate and abnormal thumbs in Diamond-Blackfan anemia patients.
18697920 2008 The role of human ribosomal proteins in the maturation of rRNA and ribosome production.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18412286 2008 RPS19 mutations in patients with Diamond-Blackfan anemia.
17647292 2007 Ribosomal protein S17 gene (RPS17) is mutated in Diamond-Blackfan anemia.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15883184 2005 Mass spectrometric analysis of the human 40S ribosomal subunit: native and HCV IRES-bound complexes.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15345747 2004 Phosphoproteomic analysis of the developing mouse brain.
15189156 2004 The molecular mechanics of eukaryotic translation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12588972 2003 Transcript-selective translational silencing by gamma interferon is directed by a novel structural element in the ceruloplasmin mRNA 3' untranslated region.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11875025 2002 The human ribosomal protein genes: sequencing and comparative analysis of 73 genes.
9847074 1998 Toward a complete human genome sequence.
9582194 1998 A map of 75 human ribosomal protein genes.
8878544 1996 Rapamycin-sensitive phosphorylation of ribosomal protein S17 by p70 S6 kinase.
8722009 Structure and evolution of mammalian ribosomal proteins.
8706699 1996 Characterization of the human small-ribosomal-subunit proteins by N-terminal and internal sequencing, and mass spectrometry.
8318536 1993 Structural arrangement of the codon-anticodon interaction area in human placenta ribosomes. Affinity labelling of the 40S subunits by derivatives of oligoribonucleotides containing the AUG codon.
7661859 1995 [Mapping the genes for ribosomal proteins S14 and S17 on human chromosomes using cDNA from a panel of hybrid cells].
3529092 1986 Homologous ribosomal proteins in bacteria, yeast, and humans.
3240863 1988 The transcriptionally active human ribosomal protein S17 gene.
1577483 1992 The mapping of seven intron-containing ribosomal protein genes shows they are unlinked in the human genome.