Property Summary

NCBI Gene PubMed Count 23
PubMed Score 29.16
PubTator Score 10.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
osteosarcoma -1.249 8.6e-04
glioblastoma -1.700 1.4e-03
intraductal papillary-mucinous adenoma (... -1.200 1.6e-03
intraductal papillary-mucinous neoplasm ... -1.200 1.2e-02
cystic fibrosis -1.300 1.4e-04
adult high grade glioma -1.400 5.1e-04
group 3 medulloblastoma 1.100 7.8e-03
subependymal giant cell astrocytoma -1.193 1.9e-02
lung adenocarcinoma -1.200 1.3e-07
inflammatory breast cancer -1.400 1.4e-05
ovarian cancer -2.100 1.7e-06

Gene RIF (3)

PMID Text
25833696 we identify RPS15A as a novel potential oncogenic gene involved in lung carcinogenesis.
25409460 The crucial role of RPS15A in promoting osteosarcoma cell proliferation.
24334120 RPS15A may play a prominent role in heptocarcinogenesis and serve as a potential therapeutic target in hepatocellular carcinoma.

AA Sequence

MVRMNVLADALKSINNAEKRGKRQVLIRPCSKVIVRFLTVMMKHGYIGEFEIIDDHRAGKIVVNLTGRLN      1 - 70
KCGVISPRFDVQLKDLEKWQNNLLPSRQFGFIVLTTSAGIMDHEEARRKHTGGKILGFFF               71 - 130
//

Text Mined References (26)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25833696 2015 Decreased expression of RPS15A suppresses proliferation of lung cancer cells.
25409460 2014 Ribosomal protein S15A augments human osteosarcoma cell proliferation in vitro.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24334120 2014 Down-regulation of ribosomal protein S15A mRNA with a short hairpin RNA inhibits human hepatic cancer cell growth in vitro.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19946888 2010 Defining the membrane proteome of NK cells.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15883184 2005 Mass spectrometric analysis of the human 40S ribosomal subunit: native and HCV IRES-bound complexes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15189156 2004 The molecular mechanics of eukaryotic translation.
15108328 2004 Human S15a expression is upregulated by hepatitis B virus X protein.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14667819 2004 Analysis of a high-throughput yeast two-hybrid system and its use to predict the function of intracellular proteins encoded within the human MHC class III region.
12588972 2003 Transcript-selective translational silencing by gamma interferon is directed by a novel structural element in the ceruloplasmin mRNA 3' untranslated region.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9582194 1998 A map of 75 human ribosomal protein genes.
8722009 Structure and evolution of mammalian ribosomal proteins.
8706699 1996 Characterization of the human small-ribosomal-subunit proteins by N-terminal and internal sequencing, and mass spectrometry.
8185605 1994 The primary structure of rat ribosomal protein S15a.