Property Summary

NCBI Gene PubMed Count 46
PubMed Score 155.24
PubTator Score 133.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
inflammatory breast cancer -1.100 1.6e-03
ovarian cancer -1.200 4.4e-04

Gene RIF (16)

AA Sequence

MAPRKGKEKKEEQVISLGPQVAEGENVFGVCHIFASFNDTFVHVTDLSGKETICRVTGGMKVKADRDESS      1 - 70
PYAAMLAAQDVAQRCKELGITALHIKLRATGGNRTKTPGPGAQSALRALARSGMKIGRIEDVTPIPSDST     71 - 140
RRKGGRRGRRL                                                               141 - 151
//

Text Mined References (59)

PMID Year Title