Property Summary

NCBI Gene PubMed Count 46
PubMed Score 152.61
PubTator Score 133.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
inflammatory breast cancer -1.100 1.6e-03
ovarian cancer -1.200 4.4e-04

Protein-protein Interaction (211)

EIF3F   EIF3D   EIF3H   RRP9   UTP20   EIF3G   EIF3J   EIF2S1   RPLP1   RPLP2   RPLP0   EIF4E   RPS17   RPSA   RPS2   RPL35A   RPL7   RPL17   EIF2S2   RPS4Y1   RPS3   EIF4B   RPL13   RPL10   RPL12   RPL9   RPL22   RPL4   RPS19   RPL3   RPL13A   EIF2S3   RPS27   RPL35   SSR1   RPL27A   RPL5   RPL21   RPL28   RPS9   RPS5   EIF1AX   RPL29   RPL34   EIF2B2   RPL14   EIF5   EIF3B   SEC61G   EIF3E   EIF4A1   RPS20   SPCS3   RPS3A   RPL26   RPL15   RPL27   RPL37A   RPL37   RPS7   RPS8   RPS15A   RPS16   RPS23   RPS18   RPS29   RPL7A   RPS4X   RPL23A   RPS6   RPL23   RPS15   RPS24   RPS25   RPS26   RPS28   FAU   RPL30   RPL39   RPL31   RPL10A   RPL32   RPL11   RPL8   RPL41   RPS27A   UBA52   RPL38   RPS21   NOP14   RPL24   RPL36A   RPL19   RPL18A   RPL6   EIF4G1   RPL18   EIF2B5   EIF3I   KRR1   EIF3A   EIF2B1   EIF4A2   EIF4H   WDR43   RNPS1   TSR1   DIEXF   EIF3M   SMG6   WDR75   DHX37   GSPT2   SMG8   WDR36   UTP15   UTP4   MAGOHB   RRP36   IMP4   LTV1   ERO1A   SMG1   EIF3C   RIOK1   RPP25   NOC4L   UTP14A   RIOK2   UPF3B   DDX47   SMG9   UPF3A   RPP21   NOL6   NOL11   UPF2   NOP10   UTP3   EIF2B3   PNO1   DCAF13   IMP3   NHP2   GAR1   EIF3K   SRP68   EIF2B4   TRMT112   TSR3   NOB1   SMG5   DDX52   FCF1   UTP11   RPL36   DDX49   RPL26L1   AK6   NAT10   CCDC137   BMS1   RBM28   YTHDC2   MYBBP1A   ZNF574   RRP12   ZNF430   SRPK1   PDCD11   STAU1   DHX30   CEBPZ   REXO4   DDX31   CCZ1   RBM19   DDX24   KRI1   CCDC59   RRP8   TTF1   GTPBP4   NOC2L   PRPF4B   RBMX2   RPL36AL   DCAF5   NOP9   DDX54   DDX18   PUM3   RPS13   CDK12   NSA2   SPTY2D1   RBM42   ZBTB24   TAF1D   NKTR   RPF2   BUD13   CENPV   PPAN-P2RY11   TAF1C   PCMTD1   SDAD1   NGDN   THAP12   ZNF121   FRMD8  

Gene RIF (16)

PMID Text
24074450 Partial silencing of RPS14 inhibits the proliferation of SKM-1, an acute myeloid leukemia cell line, and RPS14 negatively regulates p53 activation in SKM-1 cells.
23943650 Patients with nonclassical Diamond Blackfan anemia and other hypoproliferative anemias may have somatically acquired 5q deletions with RPS14 haploinsufficiency
23775087 Data indicate that RPS14 negates c-Myc functions by directly inhibiting its transcriptional activity and mediating its mRNA degradation via miRNA.
23506134 lower RPS14 predicts prolonged survival and possible response to lenalidomide in lower risk MDS patients.
23246961 RPS14 stabilized and activated p53 by inhibiting HDM2-mediated p53 polyubiquitination and degradation
22430631 Loss of RPS14 is associated with 5q-syndrome.
22391559 RPS14 and RPS19 have distinct roles in regulating the MDM2-p53 feedback loop in response to ribosomal stress
21873545 Combined loss of miR-145 and RPS14 cooperates to alter erythroid-megakaryocytic differentiation in a manner similar to the 5q- syndrome.
21068437 p53 accumulates selectively in the erythroid lineage in primary human hematopoietic progenitor cells after expression of shRNAs targeting RPS14, the ribosomal protein gene deleted in the 5q-syndrome, or RPS19.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20491881 observations in the patient setting support the importance of RPS14 in the pathogenesis of MDS with del(5q)
20193850 Studied the methylation status of the RPS14 gene in 5q deletion (5q21.3q33.1) in 24 patients. In all, 21 of the 37 patients (57%) had copy number alterations. No homozygous losses or amplifications were observed.
19794090 Myelodysplactic syndrome patients with an intermediate-1 risk score and low RPS14 expression have a superior median overall survival compared to patients with high RPS14 expression.
19773262 Observational study of gene-disease association. (HuGE Navigator)
18650472 low expression of RPS14 is not due to promoter hypermethylation, further supporting the haploinsufficiency model suggested by Ebert et al4 for the 5q- syndrome
18202658 results indicate that the 5q- syndrome is caused by a defect in RPS14 ribosomal protein function

AA Sequence

MAPRKGKEKKEEQVISLGPQVAEGENVFGVCHIFASFNDTFVHVTDLSGKETICRVTGGMKVKADRDESS      1 - 70
PYAAMLAAQDVAQRCKELGITALHIKLRATGGNRTKTPGPGAQSALRALARSGMKIGRIEDVTPIPSDST     71 - 140
RRKGGRRGRRL                                                               141 - 151
//

Text Mined References (57)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24074450 2014 Ribosomal protein S14 silencing inhibits growth of acute myeloid leukemia transformed from myelodysplastic syndromes via activating p53.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23943650 2013 Diminutive somatic deletions in the 5q region lead to a phenotype atypical of classical 5q- syndrome.
23775087 2013 Ribosomal protein S14 negatively regulates c-Myc activity.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23506134 2013 Low RPS14 expression in MDS without 5q - aberration confers higher apoptosis rate of nucleated erythrocytes and predicts prolonged survival and possible response to lenalidomide in lower risk non-5q- patients.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23246961 2014 hCINAP is a novel regulator of ribosomal protein-HDM2-p53 pathway by controlling NEDDylation of ribosomal protein S14.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
22430631 2012 Effects of L-leucine in 5q- syndrome and other RPS14-deficient erythroblasts.
22391559 2013 Ribosomal protein S14 unties the MDM2-p53 loop upon ribosomal stress.
21873545 2011 Coordinate loss of a microRNA and protein-coding gene cooperate in the pathogenesis of 5q- syndrome.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21068437 2011 Haploinsufficiency for ribosomal protein genes causes selective activation of p53 in human erythroid progenitor cells.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20491881 2010 Changes in RPS14 expression levels during lenalidomide treatment in Low- and Intermediate-1-risk myelodysplastic syndromes with chromosome 5q deletion.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20193850 2010 High-resolution oligonucleotide array comparative genomic hybridization study and methylation status of the RPS14 gene in de novo myelodysplastic syndromes.
19946888 2010 Defining the membrane proteome of NK cells.
19794090 2009 Low RPS14 expression is common in myelodysplastic syndromes without 5q- aberration and defines a subgroup of patients with prolonged survival.
19773262 2010 Diamond-Blackfan anemia: genotype-phenotype correlations in Italian patients with RPL5 and RPL11 mutations.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18650472 2008 Lack of RPS14 promoter aberrant methylation supports the haploinsufficiency model for the 5q- syndrome.
18202658 2008 Identification of RPS14 as a 5q- syndrome gene by RNA interference screen.
18088087 2008 Phosphoproteome of resting human platelets.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15883184 2005 Mass spectrometric analysis of the human 40S ribosomal subunit: native and HCV IRES-bound complexes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15189156 2004 The molecular mechanics of eukaryotic translation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12588972 2003 Transcript-selective translational silencing by gamma interferon is directed by a novel structural element in the ceruloplasmin mRNA 3' untranslated region.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9582194 1998 A map of 75 human ribosomal protein genes.
9152021 1997 Functional analysis of human RPS14 null alleles.
8722009 Structure and evolution of mammalian ribosomal proteins.
8706699 1996 Characterization of the human small-ribosomal-subunit proteins by N-terminal and internal sequencing, and mass spectrometry.
8076819 1994 The addition of 5'-coding information to a 3'-directed cDNA library improves analysis of gene expression.
7867928 1995 Regulation of human RPS14 transcription by intronic antisense RNAs and ribosomal protein S14.
7821789 1994 Construction of a human full-length cDNA bank.
7177110 1982 Selective linkage disruption in human-Chinese hamster cell hybrids: deletion mapping of the leuS, hexB, emtB, and chr genes on human chromosome 5.
3785212 1986 Primary structure of human ribosomal protein S14 and the gene that encodes it.
3683397 1987 A cloned human ribosomal protein gene functions in rodent cells.
3529092 1986 Homologous ribosomal proteins in bacteria, yeast, and humans.
1549121 1992 Fine-structure map of the human ribosomal protein gene RPS14.