Property Summary

NCBI Gene PubMed Count 32
PubMed Score 375.64
PubTator Score 78.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
diabetes mellitus 1663 3.1e-03
Disease Target Count Z-score Confidence
Cancer 2346 3.694 1.8

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus 1.700 3.1e-03

Gene RIF (6)

PMID Text
22295575 binding of ribosomal protein S13 to 18S rRNA is provided mainly by conserved motifs of the protein corresponding to those motifs in its eubacterial homologue that are involved in the interaction with 16S rRNA in the 30S subunit.
19912438 these data indicate that RPS13 could promote the growth and cell cycle progression of gastric cancer cells at least through inhibiting p27(kip1) expression.
17881366 Overproduction of rpS13 in mammalian cells interferes with splicing of its own pre-mRNA by a feedback mechanism.
15680243 Recombinant ribosomal protein S13 expressed in and isolated from E.coli was shown to be suitable for structural and functional investigations.
15149863 either RPS13 or RPL23 can promote MDR in gastric cancer cells by suppressing drug-induced apoptosis, and RPL23 may also promote MDR in gastric cancer cells through regulation of glutathione S-transferase-mediated drug-detoxifying system
12861018 S13 subunit may possess multiple functions, including a deubiquitinylating activity and distinct activities essential for cell cycle progression that require the conserved C120 residue

AA Sequence

MGRMHAPGKGLSQSALPYRRSVPTWLKLTSDDVKEQIYKLAKKGLTPSQIGVILRDSHGVAQVRFVTGNK      1 - 70
ILRILKSKGLAPDLPEDLYHLIKKAVAVRKHLERNRKDKDAKFRLILIESRIHRLARYYKTKRVLPPNWK     71 - 140
YESSTASALVA                                                               141 - 151
//

Text Mined References (40)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25854864 2015 Interaction between human BAP31 and respiratory syncytial virus small hydrophobic (SH) protein.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22295575 [Binding of human ribosomal protein S13 to the central domain of 18S rRNA].
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21269460 2011 Initial characterization of the human central proteome.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19946888 2010 Defining the membrane proteome of NK cells.
19912438 2011 Human ribosomal protein S13 promotes gastric cancer growth through down-regulating p27(Kip1).
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
17881366 2007 Human ribosomal protein S13 regulates expression of its own gene at the splicing step by a feedback mechanism.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15883184 2005 Mass spectrometric analysis of the human 40S ribosomal subunit: native and HCV IRES-bound complexes.
15680243 2005 Human ribosomal protein S13: cloning, expression, refolding, and structural stability.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15189156 2004 The molecular mechanics of eukaryotic translation.
15149863 2004 Ribosomal proteins S13 and L23 promote multidrug resistance in gastric cancer cells by suppressing drug-induced apoptosis.
14743216 2004 A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12861018 2003 Use of RNA interference and complementation to study the function of the Drosophila and human 26S proteasome subunit S13.
12588972 2003 Transcript-selective translational silencing by gamma interferon is directed by a novel structural element in the ceruloplasmin mRNA 3' untranslated region.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12054647 2002 Up-regulation of PDCD4 in senescent human diploid fibroblasts.
11790298 2002 Directed proteomic analysis of the human nucleolus.
11306805 2001 Mapping of genes and transcribed sequences in a gene rich 400-kb region on human chromosome 11p15.1-->p14.
9582194 1998 A map of 75 human ribosomal protein genes.
8920921 1996 U14 snoRNAs are encoded in introns of human ribosomal protein S13 gene.
8722009 Structure and evolution of mammalian ribosomal proteins.
8706699 1996 Characterization of the human small-ribosomal-subunit proteins by N-terminal and internal sequencing, and mass spectrometry.
8332508 1993 Cloning and analysis of the human S13 ribosomal protein cDNA.
7821789 1994 Construction of a human full-length cDNA bank.
2403345 1990 The primary structure of rat ribosomal protein S13.