Property Summary

NCBI Gene PubMed Count 31
PubMed Score 57.51
PubTator Score 99.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Aplastic anemia 19 4.145 2.1
Disease Target Count
Diamond-Blackfan anemia 30

Expression

Gene RIF (6)

PMID Text
22672539 These results are consistent with a model in which the Nef protein by binding to two components of the 40S small ribosomal subunit, RPS10 and 18S rRNA, and to a lesser extent to tRNAs, could lead to decreased protein synthesis.
22672539 HIV-1 Nef inhibits translation in vitro by interacting with two components of the 40S small ribosomal subunits, the RPS10 protein and the 18S rRNA
22510774 A novel mutation of ribosomal protein S10 gene in a Japanese patient with diamond-Blackfan anemia.
20159986 Methylation of ribosomal protein S10 by protein-arginine methyltransferase 5 regulates ribosome biogenesis.
20116044 Mutations in the RPS10 and RPS26 genes in DBA patients affect the function of the proteins in rRNA processing.
19034380 This protein has been found differentially expressed in the temporal lobe from patients with schizophrenia.

AA Sequence

MLMPKKNRIAIYELLFKEGVMVAKKDVHMPKHPELADKNVPNLHVMKAMQSLKSRGYVKEQFAWRHFYWY      1 - 70
LTNEGIQYLRDYLHLPPEIVPATLRRSRPETGRPRPKGLEGERPARLTRGEADRDTYRRSAVPPGADKKA     71 - 140
EAGAGSATEFQFRGGFGRGRGQPPQ                                                 141 - 165
//

Text Mined References (33)

PMID Year Title
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22672539 2012 The HIV-1 Nef protein interacts with two components of the 40S small ribosomal subunit, the RPS10 protein and the 18S rRNA.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22510774 2012 A novel mutation of ribosomal protein S10 gene in a Japanese patient with diamond-Blackfan anemia.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
20159986 2010 Methylation of ribosomal protein S10 by protein-arginine methyltransferase 5 regulates ribosome biogenesis.
20116044 2010 Ribosomal protein genes RPS10 and RPS26 are commonly mutated in Diamond-Blackfan anemia.
19946888 2010 Defining the membrane proteome of NK cells.
19034380 2009 Alterations in oligodendrocyte proteins, calcium homeostasis and new potential markers in schizophrenia anterior temporal lobe are revealed by shotgun proteome analysis.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15883184 2005 Mass spectrometric analysis of the human 40S ribosomal subunit: native and HCV IRES-bound complexes.
15635413 2005 Nucleolar proteome dynamics.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15345747 2004 Phosphoproteomic analysis of the developing mouse brain.
15189156 2004 The molecular mechanics of eukaryotic translation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12651107 2003 Expression and purification of human ribosomal proteins S3, S5, S10, S19, and S26.
12588972 2003 Transcript-selective translational silencing by gamma interferon is directed by a novel structural element in the ceruloplasmin mRNA 3' untranslated region.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11751223 2001 Differential expression of genes coding for ribosomal proteins in different human tissues.
11121577 2000 Proteins S7, S10, S16 and S19 of the human 40S ribosomal subunit are most resistant to dissociation by salt.
10409428 1999 Gene expression in proliferating human erythroid cells.
9915854 1999 Pituitary tumor-transforming gene protein associates with ribosomal protein S10 and a novel human homologue of DnaJ in testicular cells.
9582194 1998 A map of 75 human ribosomal protein genes.
8722009 Structure and evolution of mammalian ribosomal proteins.
8706699 1996 Characterization of the human small-ribosomal-subunit proteins by N-terminal and internal sequencing, and mass spectrometry.
7772601 1995 Cloning, sequencing and expression of the L5, L21, L27a, L28, S5, S9, S10 and S29 human ribosomal protein mRNAs.