Property Summary

NCBI Gene PubMed Count 19
PubMed Score 23.37
PubTator Score 19.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma 3.400 8.4e-08
osteosarcoma 1.104 1.1e-02
posterior fossa group B ependymoma -2.300 1.1e-07
glioblastoma -1.700 1.6e-02
atypical teratoid / rhabdoid tumor -2.300 4.2e-04
medulloblastoma -1.800 7.1e-03
primitive neuroectodermal tumor -1.600 5.0e-02
adrenocortical carcinoma -1.223 3.8e-02
adult high grade glioma -1.400 3.4e-02
pilocytic astrocytoma -1.200 1.1e-02
lung carcinoma 3.200 8.5e-16
gastric carcinoma -2.600 6.4e-03
ovarian cancer -1.200 2.1e-07
pituitary cancer -2.800 1.7e-04
facioscapulohumeral dystrophy 2.500 1.2e-03

Gene RIF (13)

PMID Text
26823831 The DNA methylation of both Reprimo and hMLH1 genes depressed the protein expression, and may participate in the occurrence and progression and gastric cancer
25954972 Positive association between RPRM and p73 expression suggest that other members of the p53 gene family may participate in the regulation of RPRM expression.
25954972 Loss of expression of Reprimo (RPRM), a p53-induced cell cycle arrest gene correlates with invasive stage of tumor progression and p73 expression in gastric cancer. These findings suggest that other members of the p53 gene family may participate in the regulation of RPRM expression
25629980 tp53-dependent G2 arrest mediator candidate gene, Reprimo, is down-regulated by promoter hypermethylation in pediatric acute myeloid leukemia
23982217 Reprimo expression is normally induced in response to DNA damage, acting as a novel tumor suppressor in gastric cancer; however, Reprimo methylation abrogates its expression and effects
23312294 study concludes that LMP-1 may induce cell cycle arrest at G(2)/M progression via upregulation of 14-3-3sigma and Reprimo
22562171 RPRM is transiently up-regulated at a posttranscriptional level in times of cellular stress to restrict cell survival, proliferation, and tumor formation
20949468 Loss of Reprimo and S100A2 expressions occurs frequently in gastric adenocarcinomas. The expressions of Reprimo and S100A2 may be potential biomarkers for gastric adenocarcinomas detection.
19917725 these data implicate a novel role for HDAC7 and FoxA1 in estrogen repression of RPRM.
18829507 Aberrant hypermethylation of Reprimo is high in primary gastric cancer as well as in pair plasma samples. In plasma from asymptomatic controls, Reprimo is infrequently methylated. Reprimo is a potential biomarker for early detection of gastric cancer.
18197409 An association between the Reprimo 824G>C heterozygote and diverticular disease may exist on the basis of deviation from Hardy-Weinberg equilibrium.
18197409 Observational study of gene-disease association. (HuGE Navigator)
16752411 Results suggest that aberrant methylation of Reprimo is a common event in pancreatic carcinogenesis and is associated with genetic instability.

AA Sequence

MNPALGNQTDVAGLFLANSSEALERAVRCCTQASVVTDDGFAEGGPDERSLYIMRVVQIAVMCVLSLTVV      1 - 70
FGIFFLGCNLLIKSEGMINFLVKDRRPSKEVEAVVVGPY                                    71 - 109
//

Text Mined References (22)

PMID Year Title
26823831 2015 Implication of Reprimo and hMLH1 gene methylation in early diagnosis of gastric carcinoma.
25954972 2015 Loss of Expression of Reprimo, a p53-induced Cell Cycle Arrest Gene, Correlates with Invasive Stage of Tumor Progression and p73 Expression in Gastric Cancer.
25629980 2015 tp53-dependent G2 arrest mediator candidate gene, Reprimo, is down-regulated by promoter hypermethylation in pediatric acute myeloid leukemia.
25416956 2014 A proteome-scale map of the human interactome network.
23982217 2013 DNA damage-inducible gene, reprimo functions as a tumor suppressor and is suppressed by promoter methylation in gastric cancer.
23720494 2013 Genome-wide association study identifies loci affecting blood copper, selenium and zinc.
23312294 2012 Epstein-Barr virus-encoded latent membrane protein-1 upregulates 14-3-3? and Reprimo to confer G(2)/M phase cell cycle arrest.
22562171 2012 Reprimo (RPRM) is a novel tumor suppressor in pituitary tumors and regulates survival, proliferation, and tumorigenicity.
20949468 2011 Loss of Reprimo and S100A2 expression in human gastric adenocarcinoma.
19917725 2010 Histone deacetylase 7 and FoxA1 in estrogen-mediated repression of RPRM.
18829507 2008 Reprimo as a potential biomarker for early detection in gastric cancer.
18197409 2008 Reprimo 824 G>C and p53R2 4696 C>G single nucleotide polymorphisms and colorectal cancer: a case-control disease association study.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16752411 2006 Aberrant methylation of Reprimo correlates with genetic instability and predicts poor prognosis in pancreatic ductal adenocarcinoma.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12395409 2002 Identification of polymorphisms in the human Reprimo gene using public EST data.
10930422 2000 Reprimo, a new candidate mediator of the p53-mediated cell cycle arrest at the G2 phase.