Property Summary

NCBI Gene PubMed Count 19
PubMed Score 21.05
PubTator Score 8.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (1)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.961 7.3e-04

 GWAS Trait (1)

Gene RIF (10)

AA Sequence

MSSFSESALEKKLSELSNSQQSVQTLSLWLIHHRKHAGPIVSVWHRELRKAKSNRKLTFLYLANDVIQNS      1 - 70
KRKGPEFTREFESVLVDAFSHVAREADEGCKKPLERLLNIWQERSVYGGEFIQQLKLSMEDSKSPPPKAT     71 - 140
EEKKSLKRTFQQIQEEEDDDYPGSYSPQDPSAGPLLTEELIKALQDLENAASGDATVRQKIASLPQEVQD    141 - 210
VSLLEKITDKEAAERLSKTVDEACLLLAEYNGRLAAELEDRRQLARMLVEYTQNQKDVLSEKEKKLEEYK    211 - 280
QKLARVTQVRKELKSHIQSLPDLSLLPNVTGGLAPLPSAGDLFSTD                            281 - 326
//

Text Mined References (29)

PMID Year Title