Property Summary

NCBI Gene PubMed Count 10
PubMed Score 7.15
PubTator Score 5.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
oligodendroglioma 1.400 1.0e-02
psoriasis 2.100 2.4e-04
osteosarcoma 1.859 1.5e-03
cystic fibrosis 1.110 4.2e-05
atypical teratoid / rhabdoid tumor -1.300 2.6e-04
glioblastoma -1.300 8.0e-04
hereditary spastic paraplegia -1.127 5.3e-03
pancreatic ductal adenocarcinoma liver m... -1.728 4.6e-02
tuberculosis and treatment for 6 months -1.500 1.6e-04
non-small cell lung cancer 1.087 6.0e-14
lung cancer 1.900 6.9e-03
Breast cancer 3.300 4.1e-02
adult high grade glioma -1.400 3.1e-05
aldosterone-producing adenoma -1.131 1.2e-02
invasive ductal carcinoma 1.100 5.6e-03
ovarian cancer -1.800 3.7e-05

Gene RIF (5)

PMID Text
25697359 Data suggest that p15RS (p15INK4b-related sequence) acts as an intrinsic transcriptional repressor for Wnt/beta-catenin-mediated gene transcription through recruiting HDAC2 histone deacetylase.
24997600 RPRD1A and RPRD1B associate directly with RPAP2 phosphatase and coordinate the dephosphorylation of RNAPII phospho-S5 by RPAP2.
22580456 The p15RS expression specifically downregulates the expression of cathepsin B and MMP-9 at RNA levels, which are known to promote cell invasion through degrading extracellular matrix proteins.
20739273 p15RS inhibits Wnt signaling by interrupting beta-catenin.TCF4 complex formation and that Wnt signaling initiates downstream gene expression by removing p15RS from promoters.
12470661 molecular cloning and characterization of P15RS, a novel P15(INK4b) related gene involved in G1/S progression

AA Sequence

MSAFSEAALEKKLSELSNSQQSVQTLSLWLIHHRKHSRPIVTVWERELRKAKPNRKLTFLYLANDVIQNS      1 - 70
KRKGPEFTKDFAPVIVEAFKHVSSETDESCKKHLGRVLSIWEERSVYENDVLEQLKQALYGDKKPRKRTY     71 - 140
EQIKVDENENCSSLGSPSEPPQTLDLVRALQDLENAASGDAAVHQRIASLPVEVQEVSLLDKITDKESGE    141 - 210
RLSKMVEDACMLLADYNGRLAAEIDDRKQLTRMLADFLRCQKEALAEKEHKLEEYKRKLARVSLVRKELR    211 - 280
SRIQSLPDLSRLPNVTGSHMHLPFAGDIYSED                                          281 - 312
//

Text Mined References (16)

PMID Year Title
25697359 2015 p15RS/RPRD1A (p15INK4b-related sequence/regulation of nuclear pre-mRNA domain-containing protein 1A) interacts with HDAC2 in inhibition of the Wnt/?-catenin signaling pathway.
25416956 2014 A proteome-scale map of the human interactome network.
24997600 2014 RPRD1A and RPRD1B are human RNA polymerase II C-terminal domain scaffolds for Ser5 dephosphorylation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24223155 2013 Genome wide analysis of drug-induced torsades de pointes: lack of common variants with large effect sizes.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22580456 2012 Cellular and molecular evidence for malignancy-inhibitory functions of p15RS.
22231121 Control of the RNA polymerase II phosphorylation state in promoter regions by CTD interaction domain-containing proteins RPRD1A and RPRD1B.
21269460 2011 Initial characterization of the human central proteome.
20739273 2010 p15RS attenuates Wnt/{beta}-catenin signaling by disrupting {beta}-catenin·TCF4 Interaction.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12470661 2002 Identification and characterization of P15RS, a novel P15(INK4b) related gene on G1/S progression.