1. Home
  2. Targets
  3. nucleic acid binding
  4. nuclease
  5. endoribonuclease
  6. Ribonuclease P protein subunit p30

Tdark Ribonuclease P protein subunit p30

Component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends.

 Comments

Property Summary

NCBI Gene PubMed Count 20
PubMed Score 13.67
PubTator Score 12.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (12)

Disease log2 FC p
osteosarcoma -1.698 2.4e-03
ependymoma -1.100 6.5e-04
glioblastoma -2.000 1.9e-04
atypical teratoid / rhabdoid tumor -1.900 6.1e-05
medulloblastoma -1.600 2.4e-04
medulloblastoma, large-cell -1.800 8.3e-05
primitive neuroectodermal tumor -1.100 2.0e-03
tuberculosis and treatment for 6 months -1.400 7.8e-05
adult high grade glioma -1.600 1.8e-03
pilocytic astrocytoma -1.100 3.5e-03
ovarian cancer 1.200 1.9e-05
pituitary cancer 1.300 2.7e-05

Synonym

Accession P78346 B2R799 E9PB02 RNaseP protein p30
Symbols TSG15

Gene

RPP30

PANTHER Protein Class (3)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 UniProt Keyword (10)

 GO Function (3)

 GO Component (3)

 GO Process (3)

 Compartment GO Term (34)

See all...

 GWAS Trait (1)

 HCA RNA Cell Line (56)

See all...

Pathway (9)

Protein-protein Interaction (56)

POLR3G   POP7   RPP40   RPS17   RPSA   RPS2   RPS4Y1   RPS3   RPS12   RPS19   RPS27   RPS9   RPS5   RPS10   RPS20   RPS3A   RPS7   RPS8   RPS15A   RPS16   RPS14   RPS23   RPS18   RPS29   RPS13   RPS11   RPS4X   RPS6   RPS15   RPS24   RPS25   RPS26   RPS28   FAU   RPS27A   RPS21   RPP38   TSR1   POP5   LTV1   POP1   ELAC2   RIOK1   POLR3GL   POLR3C   RPP25   RIOK2   RPP21   PNO1   POLR3E   POLR3B   NOB1   POLR3H   RPP14   RPP25L   NEPRO  

Gene RIF (2)

PMID Text
25704799 archaeal homologs of the human RNase P proteins Pop5 and Rpp30
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence 

MAVFADLDLRAGSDLKALRGLVETAAHLGYSVVAINHIVDFKEKKQEIEKPVAVSELFTTLPIVQGKSRP      1 - 70
IKILTRLTIIVSDPSHCNVLRATSSRARLYDVVAVFPKTEKLFHIACTHLDVDLVCITVTEKLPFYFKRP     71 - 140
PINVAIDRGLAFELVYSPAIKDSTMRRYTISSALNLMQICKGKNVIISSAAERPLEIRGPYDVANLGLLF    141 - 210
GLSESDAKAAVSTNCRAALLHGETRKTAFGIISTVKKPRPSEGDEDCLPASKKAKCEG                211 - 268
//

Text Mined References (27)

PMID Year Title
25704799 2015 On archaeal homologs of the human RNase P proteins Pop5 and Rpp30 in the hyperthermophilic archaeon Thermococcus kodakarensis.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22566634 2012 The genetic architecture of economic and political preferences.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17033964 2006 Mutations of the mitochondrial holocytochrome c-type synthase in X-linked dominant microphthalmia with linear skin defects syndrome.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15096576 2004 Mutual interactions between subunits of the human RNase MRP ribonucleoprotein complex.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11455963 2001 Protein-RNA interactions in the subunits of human nuclear RNase P.
9630247 1998 Autoantigenic properties of some protein subunits of catalytically active complexes of human ribonuclease P.
9308968 1997 Rpp1, an essential protein subunit of nuclear RNase P required for processing of precursor tRNA and 35S precursor rRNA in Saccharomyces cerevisiae.
9037013 1997 Characterization of two scleroderma autoimmune antigens that copurify with human ribonuclease P.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.