Property Summary

NCBI Gene PubMed Count 12
PubMed Score 35.88
PubTator Score 11.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

Gene RIF (1)

AA Sequence

MAGPVKDREAFQRLNFLYQAAHCVLAQDPENQALARFYCYTERTIAKRLVLRRDPSVKRTLCRGCSSLLV      1 - 70
PGLTCTQRQRRCRGQRWTVQTCLTCQRSQRFLNDPGHLLWGDRPEAQLGSQADSKPLQPLPNTAHSISDR     71 - 140
LPEEKMQTQGSSNQ                                                            141 - 154
//

Text Mined References (14)

PMID Year Title