Property Summary

NCBI Gene PubMed Count 17
PubMed Score 1.00
PubTator Score 380.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 1.5e-06

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.676 1.5e-06

Gene RIF (1)

AA Sequence

MPAPAATYERVVYKNPSEYHYMKVCLEFQDCGVGLNAAQFKQLLISAVKDLFGEVDAALPLDILTYEEKT      1 - 70
LSAILRICSSGLVKLWSSLTLLGSYKGKKCAFRVIQVSPFLLALSGNSRELVLD                     71 - 124
//

Text Mined References (19)

PMID Year Title