Property Summary

NCBI Gene PubMed Count 26
PubMed Score 139.13
PubTator Score 53.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung adenocarcinoma 2714 3.6e-09
ovarian cancer 8491 8.6e-05
osteosarcoma 7933 2.7e-04
Multiple Sclerosis 498 5.0e-04
breast carcinoma 1614 2.3e-03
glioblastoma 5572 2.6e-03
Multiple myeloma 1327 4.5e-03
astrocytoma 1493 8.4e-03

Expression

  Differential Expression (8)

Disease log2 FC p
Multiple myeloma 1.354 4.5e-03
osteosarcoma 1.605 2.7e-04
astrocytoma 1.300 8.4e-03
glioblastoma 1.300 2.6e-03
breast carcinoma 1.400 2.3e-03
Multiple Sclerosis 1.300 5.0e-04
lung adenocarcinoma 1.377 3.6e-09
ovarian cancer 2.100 8.6e-05

Gene RIF (5)

PMID Text
23166591 Expression of HIV-1 Tat upregulates the abundance of ribophorin I (RPN1) in the nucleoli of Jurkat T-cells
23125841 Expression of HIV-1 Tat upregulates the abundance of ribophorin I (RPN1) in the nucleoli of Jurkat T-cells
22988243 Data indicate that malectin functions by forming a complex with ribophorin I.
19064571 Observational study of gene-disease association. (HuGE Navigator)
18607003 ribophorin I can regulate the delivery of precursor proteins to the OST complex by capturing substrates and presenting them to the catalytic core.

AA Sequence

MEAPAAGLFLLLLLGTWAPAPGSASSEAPPLINEDVKRTVDLSSHLAKVTAEVVLAHLGGGSTSRATSFL      1 - 70
LALEPELEARLAHLGVQVKGEDEEENNLEVRETKIKGKSGRFFTVKLPVALDPGAKISVIVETVYTHVLH     71 - 140
PYPTQITQSEKQFVVFEGNHYFYSPYPTKTQTMRVKLASRNVESYTKLGNPTRSEDLLDYGPFRDVPAYS    141 - 210
QDTFKVHYENNSPFLTITSMTRVIEVSHWGNIAVEENVDLKHTGAVLKGPFSRYDYQRQPDSGISSIRSF    211 - 280
KTILPAAAQDVYYRDEIGNVSTSHLLILDDSVEMEIRPRFPLFGGWKTHYIVGYNLPSYEYLYNLGDQYA    281 - 350
LKMRFVDHVFDEQVIDSLTVKIILPEGAKNIEIDSPYEISRAPDELHYTYLDTFGRPVIVAYKKNLVEQH    351 - 420
IQDIVVHYTFNKVLMLQEPLLVVAAFYILFFTVIIYVRLDFSITKDPAAEARMKVACITEQVLTLVNKRI    421 - 490
GLYRHFDETVNRYKQSRDISTLNSGKKSLETEHKALTSEIALLQSRLKTEGSDLCDRVSEMQKLDAQVKE    491 - 560
LVLKSAVEAERLVAGKLKKDTYIENEKLISGKRQELVTKIDHILDAL                           561 - 607
//

Text Mined References (35)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23314186 2013 Genetic variation associated with circulating monocyte count in the eMERGE Network.
22988243 2012 Malectin forms a complex with ribophorin I for enhanced association with misfolded glycoproteins.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22016385 2011 Selenoprotein K binds multiprotein complexes and is involved in the regulation of endoplasmic reticulum homeostasis.
21738480 2011 Multiple loci are associated with white blood cell phenotypes.
21269460 2011 Initial characterization of the human central proteome.
19946888 2010 Defining the membrane proteome of NK cells.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19167329 2009 Cotranslational and posttranslational N-glycosylation of polypeptides by distinct mammalian OST isoforms.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19064571 2008 Polymorphisms in mitochondrial genes and prostate cancer risk.
18607003 2008 Ribophorin I regulates substrate delivery to the oligosaccharyltransferase core.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17264154 2007 Ribophorin I acts as a substrate-specific facilitator of N-glycosylation.
17081065 2006 Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
15835887 2005 Proteomic analysis of mammalian oligosaccharyltransferase reveals multiple subcomplexes that contain Sec61, TRAP, and two potential new subunits.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12887896 2003 Oligosaccharyltransferase isoforms that contain different catalytic STT3 subunits have distinct enzymatic properties.
12643545 Proteomic analysis of early melanosomes: identification of novel melanosomal proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12200120 2002 Identification of ubiquitin-like protein-binding subunits of the 26S proteasome.
12198498 2002 Proteasome subunit Rpn1 binds ubiquitin-like protein domains.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10660554 2000 Retention of subunits of the oligosaccharyltransferase complex in the endoplasmic reticulum.
9307271 1997 Activation of a novel gene in 3q21 and identification of intergenic fusion transcripts with ecotropic viral insertion site I in leukemia.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
3034581 1987 Human ribophorins I and II: the primary structure and membrane topology of two highly conserved rough endoplasmic reticulum-specific glycoproteins.