Property Summary

NCBI Gene PubMed Count 36
PubMed Score 29.78
PubTator Score 90.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

Gene RIF (7)

PMID Text
26176264 absence of RPLP0, RPLP1, or RPLP2 resulted in reactive oxygen species (ROS) accumulation and MAPK1/ERK2 signaling pathway activation.
23400861 Evaluated autoantibodies against native ribosomal P complex and recombinant ribosomal P proteins (anti-Rib-P0, anti-Rib-P1, anti-Rib-P2) for prevalence, diagnostic relevance&clinical associations in a Chinese cohort with systemic lupus erythematosus.
22909382 Data show that ricin A-chain (RTA) interacts directly with recombinant P1-P2 dimer, indicating the importance of P1 and P2 in enabling RTA to bind and depurinate ribosomes.
21040949 P proteins are up-regulated in a considerable number of patients with the most common types of cancer.
18675807 These results support the hypothesis that at least some of the changes in the profile of newly synthesized proteins detected in cells deprived of P1 and P2 proteins might be due to an effect on the efficiency of cap-independent translation.
18422483 Data indicate that P1/P2 proteins modulate cytoplasmic translation by influencing the interaction between subunits, thereby regulating the rate of cell proliferation.
12479870 the P1 and P2 proteins are not actively transported into the nucleus compartment, remaining predominantly in the cytoplasm (the perinuclear compartment).

AA Sequence

MASVSELACIYSALILHDDEVTVTEDKINALIKAAGVNVEPFWPGLFAKALANVNIGSLICNVGAGGPAP      1 - 70
AAGAAPAGGPAPSTAAAPAEEKKVEAKKEESEESDDDMGFGLFD                               71 - 114
//

Text Mined References (42)

PMID Year Title
26176264 2015 Disruption of the ribosomal P complex leads to stress-induced autophagy.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24292274 2014 A genome-wide association study identifies multiple susceptibility loci for chronic lymphocytic leukemia.
23770605 2013 Genome-wide association study identifies multiple risk loci for chronic lymphocytic leukemia.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23400861 2013 Significance of antibodies against the native ribosomal P protein complex and recombinant P0, P1, and P2 proteins in the diagnosis of Chinese patients with systemic lupus erythematosus.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22909382 2012 The P1/P2 proteins of the human ribosomal stalk are required for ribosome binding and depurination by ricin in human cells.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22135285 2012 Solution structure of the dimerization domain of the eukaryotic stalk P1/P2 complex reveals the structural organization of eukaryotic stalk complex.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21269460 2011 Initial characterization of the human central proteome.
21040949 2011 Expression of the ribosomal proteins Rplp0, Rplp1, and Rplp2 in gynecologic tumors.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18675807 2008 Internal translation initiation on the foot-and-mouth disease virus IRES is affected by ribosomal stalk conformation.
18422483 2008 Functional characterization of ribosomal P1/P2 proteins in human cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16807684 2006 Phosphoproteomic analysis of the human pituitary.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16341674 2005 Transcriptome analysis of human gastric cancer.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
16097034 2005 Global phosphoproteome analysis on human HepG2 hepatocytes using reversed-phase diagonal LC.
16094384 2005 Quantitative phosphoproteome analysis using a dendrimer conjugation chemistry and tandem mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15189156 2004 The molecular mechanics of eukaryotic translation.
14997482 2004 Identification and characterization of phosphorylated proteins in the human pituitary.
14729942 2004 Identification of phosphoproteins and their phosphorylation sites in the WEHI-231 B lymphoma cell line.
14567916 2003 Regulated release of L13a from the 60S ribosomal subunit as a mechanism of transcript-specific translational control.
12962325 2003 Characterization and analysis of posttranslational modifications of the human large cytoplasmic ribosomal subunit proteins by mass spectrometry and Edman sequencing.
12479870 2003 The subcellular distribution of the human ribosomal "stalk" components: P1, P2 and P0 proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12054647 2002 Up-regulation of PDCD4 in senescent human diploid fibroblasts.
11875025 2002 The human ribosomal protein genes: sequencing and comparative analysis of 73 genes.
11401437 2001 A complete map of the human ribosomal protein genes: assignment of 80 genes to the cytogenetic map and implications for human disorders.
11277934 2001 Trichosanthin interacts with acidic ribosomal proteins P0 and P1 and mitotic checkpoint protein MAD2B.
10856704 2000 Analysis of the protein-protein interactions between the human acidic ribosomal P-proteins: evaluation by the two hybrid system.
8722009 Structure and evolution of mammalian ribosomal proteins.
7821789 1994 Construction of a human full-length cDNA bank.
3323886 1987 Human acidic ribosomal phosphoproteins P0, P1, and P2: analysis of cDNA clones, in vitro synthesis, and assembly.