Property Summary

NCBI Gene PubMed Count 20
PubMed Score 74.58
PubTator Score 48.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Brucellosis 24 3.399 1.7

Expression

Gene RIF (3)

PMID Text
26655239 The authors propose that during rabies virus infection, viral phosphoprotein P binds to ribosomal protein L9 that translocates from the nucleus to the cytoplasm, inhibiting the initial stage of viral transcription.
23125841 Tandem affinity purification and mass spectrometry analysis identify ribosomal protein L9 (RPL9), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22944692 Tandem affinity purification and mass spectrometry analysis identify ribosomal protein L9 (RPL9), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells

AA Sequence

MKTILSNQTVDIPENVDITLKGRTVIVKGPRGTLRRDFNHINVELSLLGKKKKRLRVDKWWGNRKELATV      1 - 70
RTICSHVQNMIKGVTLGFRYKMRSVYAHFPINVVIQENGSLVEIRNFLGEKYIRRVRMRPGVACSVSQAQ     71 - 140
KDELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKGTVQQADE                      141 - 192
//

Text Mined References (26)

PMID Year Title
26655239 2016 Rabies virus phosphoprotein interacts with ribosomal protein L9 and affects rabies virus replication.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21269460 2011 Initial characterization of the human central proteome.
19946888 2010 Defining the membrane proteome of NK cells.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16341674 2005 Transcriptome analysis of human gastric cancer.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15189156 2004 The molecular mechanics of eukaryotic translation.
14567916 2003 Regulated release of L13a from the 60S ribosomal subunit as a mechanism of transcript-specific translational control.
12962325 2003 Characterization and analysis of posttranslational modifications of the human large cytoplasmic ribosomal subunit proteins by mass spectrometry and Edman sequencing.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11790298 2002 Directed proteomic analysis of the human nucleolus.
9582194 1998 A map of 75 human ribosomal protein genes.
8722009 Structure and evolution of mammalian ribosomal proteins.
8597601 1996 Structural organization and chromosomal localization of the human ribosomal protein L9 gene.
8415001 1993 A new human ribosomal protein sequence, homologue of rat L9.