Property Summary

NCBI Gene PubMed Count 22
PubMed Score 41.56
PubTator Score 8.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Large intestine cancer 126 0.0 0.6
Disease Target Count Z-score Confidence
Hemangioma 69 3.484 1.7
Facial paralysis 18 3.077 1.5

Expression

Gene RIF (4)

AA Sequence

MGRVIRGQRKGAGSVFRAHVKHRKGAARLRAVDFAERHGYIKGIVKDIIHDPGRGAPLAKVVFRDPYRFK      1 - 70
KRTELFIAAEGIHTGQFVYCGKKAQLNIGNVLPVGTMPEGTIVCCLEEKPGDRGKLARASGNYATVISHN     71 - 140
PETKKTRVKLPSGSKKVISSANRAVVGVVAGGGRIDKPILKAGRAYHKYKAKRNCWPRVRGVAMNPVEHP    141 - 210
FGGGNHQHIGKPSTIRRDAPAGRKVGLIAARRTGRLRGTKTVQEKEN                           211 - 257
//

Text Mined References (30)

PMID Year Title