Property Summary

NCBI Gene PubMed Count 37
PubMed Score 143.89
PubTator Score 45.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
Breast cancer 1.400 3.9e-11
invasive ductal carcinoma 1.300 7.7e-03

Gene RIF (8)

PMID Text
23266416 In case of L7, importin beta2 or importin beta3 are preferentially used by clusters with a high import efficiency.
23125841 Tandem affinity purification and mass spectrometry analysis identify ribosomal protein L7 (RPL7), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22944692 Tandem affinity purification and mass spectrometry analysis identify ribosomal protein L7 (RPL7), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
21509594 RPL7 gene expression is decreased in follicular variant of papillary thyroid carcinoma.
20828572 importin beta3 is essential for the nuclear import of RPL7. The import is mediated via the multifaceted basic amino acid clusters present in the NH(2)-region of RPL7, and is RanGTP-dependent
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17258209 L7-endoplasmic reticulum-binding nature could be one of multiple factors that allow a nascent peptide-less ribosome to remain at the endoplasmic reticulum.
16797011 Combining with the phylogenic findings from homologous sequence alignment, the NH2-region of L7, besides being as a eukaryotic expansion segment, can be excluded from building a functional eukaryotic ribosome.

AA Sequence

MEGVEEKKKEVPAVPETLKKKRRNFAELKIKRLRKKFAQKMLRKARRKLIYEKAKHYHKEYRQMYRTEIR      1 - 70
MARMARKAGNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGTFVKLNKASINMLRIVEPYI     71 - 140
AWGYPNLKSVNELIYKRGYGKINKKRIALTDNALIARSLGKYGIICMEDLIHEIYTVGKRFKEANNFLWP    141 - 210
FKLSSPRGGMKKKTTHFVEGGDAGNREDQINRLIRRMN                                    211 - 248
//

Text Mined References (46)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25854864 2015 Interaction between human BAP31 and respiratory syncytial virus small hydrophobic (SH) protein.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23266416 2013 The quantitative assessment of the role played by basic amino acid clusters in the nuclear uptake of human ribosomal protein L7.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22412388 2012 A genome-wide scan of Ashkenazi Jewish Crohn's disease suggests novel susceptibility loci.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21509594 2011 Differential expression of a set of genes in follicular and classic variants of papillary thyroid carcinoma.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21269460 2011 Initial characterization of the human central proteome.
20828572 2010 Importin ?3 mediates the nuclear import of human ribosomal protein L7 through its interaction with the multifaceted basic clusters of L7.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19946888 2010 Defining the membrane proteome of NK cells.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18809582 2008 Nucleophosmin serves as a rate-limiting nuclear export chaperone for the Mammalian ribosome.
18697920 2008 The role of human ribosomal proteins in the maturation of rRNA and ribosome production.
18274552 2008 Ribosomal proteins are targets for the NEDD8 pathway.
17258209 2007 Human ribosomal protein L7 displays an ER binding property and is involved in ribosome-ER association.
16797011 2006 Mapping the essential structures of human ribosomal protein L7 for nuclear entry, ribosome assembly and function.
16791210 2006 Dynamic proteomics in individual human cells uncovers widespread cell-cycle dependence of nuclear proteins.
15635413 2005 Nucleolar proteome dynamics.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15189156 2004 The molecular mechanics of eukaryotic translation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14567916 2003 Regulated release of L13a from the 60S ribosomal subunit as a mechanism of transcript-specific translational control.
12962325 2003 Characterization and analysis of posttranslational modifications of the human large cytoplasmic ribosomal subunit proteins by mass spectrometry and Edman sequencing.
12704204 2003 Differential expression of ribosomal proteins in human normal and neoplastic colorectum.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12401809 2003 Identification of natural ligands for the orphan G protein-coupled receptors GPR7 and GPR8.
11790298 2002 Directed proteomic analysis of the human nucleolus.
9582194 1998 A map of 75 human ribosomal protein genes.
9268371 1997 Specific interactions of the autoantigen L7 with multi-zinc finger protein ZNF7 and ribosomal protein S7.
8722009 Structure and evolution of mammalian ribosomal proteins.
8441630 1993 Structural and functional properties of ribosomal protein L7 from humans and rodents.
8360149 1993 Identification of a transcript that is down-regulated in senescent human fibroblasts. Cloning, sequence analysis, and regulation of the human L7 ribosomal protein gene.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7862521 1995 Human ribosomal protein L7 inhibits cell-free translation in reticulocyte lysates and affects the expression of nuclear proteins upon stable transfection into Jurkat T-lymphoma cells.
7750987 1994 Characterization of eukaryotic protein L7 as a novel autoantigen which frequently elicits an immune response in patients suffering from systemic autoimmune disease.