Property Summary

NCBI Gene PubMed Count 33
PubMed Score 37.78
PubTator Score 23.99

Knowledge Summary

Patent

No data available

Expression

Gene RIF (7)

PMID Text
24174547 The ribosomal protein L6 binds to and suppresses the E3 ubiquitin ligase activity of HDM2, and subsequently attenuates HDM2-mediated p53 polyubiquitination and degradation.
23125841 Tandem affinity purification and mass spectrometry analysis identify ribosomal protein L6 (RPL6), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22944692 Tandem affinity purification and mass spectrometry analysis identify ribosomal protein L6 (RPL6), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22174317 Tandem affinity purification and mass spectrometry analysis identify ribosomal protein L6 (RPL6), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22043320 Down-regulation of RPL6 could suppress cell growth and cell cycle progression at least through down-regulating cyclin E
20171175 RPL6 was overexpressed in human gastric cancer and its over-expression could promote cell growth and cell cycle progression at least through upregulating cyclin E expression.
12678981 The high expression of RPL6/Taxreb107 in drug resistant gastric cancer cell shows its correlation with multiple-drug resistance in gastric cancer.

AA Sequence

MAGEKVEKPDTKEKKPEAKKVDAGGKVKKGNLKAKKPKKGKPHCSRNPVLVRGIGRYSRSAMYSRKAMYK      1 - 70
RKYSAAKSKVEKKKKEKVLATVTKPVGGDKNGGTRVVKLRKMPRYYPTEDVPRKLLSHGKKPFSQHVRKL     71 - 140
RASITPGTILIILTGRHRGKRVVFLKQLASGLLLVTGPLVLNRVPLRRTHQKFVIATSTKIDISNVKIPK    141 - 210
HLTDAYFKKKKLRKPRHQEGEIFDTEKEKYEITEQRKIDQKAVDSQILPKIKAIPQLQGYLRSVFALTNG    211 - 280
IYPHKLVF                                                                  281 - 288
//

Text Mined References (39)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24174547 2014 Regulation of the HDM2-p53 pathway by ribosomal protein L6 in response to ribosomal stress.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22043320 2011 Downregulation of RPL6 by siRNA inhibits proliferation and cell cycle progression of human gastric cancer cell lines.
21642993 2011 Genome-wide association study identifies three new susceptibility loci for esophageal squamous-cell carcinoma in Chinese populations.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21572416 2011 Meta-analysis of genome-wide association studies identifies common variants associated with blood pressure variation in east Asians.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21269460 2011 Initial characterization of the human central proteome.
20171175 2010 Ribosomal protein L6 promotes growth and cell cycle progression through upregulating cyclin E in gastric cancer cells.
19946888 2010 Defining the membrane proteome of NK cells.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
17924679 2007 Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15121898 2004 The composition of Staufen-containing RNA granules from human cells indicates their role in the regulated transport and translation of messenger RNAs.
14743216 2004 A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway.
14567916 2003 Regulated release of L13a from the 60S ribosomal subunit as a mechanism of transcript-specific translational control.
12962325 2003 Characterization and analysis of posttranslational modifications of the human large cytoplasmic ribosomal subunit proteins by mass spectrometry and Edman sequencing.
12678981 2003 [Differential expression of RPL6/Taxreb107 in drug resistant gastric cancer cell line SGC7901/ADR and its correlation with multiple-drug resistance].
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11823430 2002 Importins fulfil a dual function as nuclear import receptors and cytoplasmic chaperones for exposed basic domains.
11790298 2002 Directed proteomic analysis of the human nucleolus.
11401437 2001 A complete map of the human ribosomal protein genes: assignment of 80 genes to the cytogenetic map and implications for human disorders.
11043511 2000 The human ribosomal protein L6 gene in a critical region for Noonan syndrome.
10944468 2000 cDNA cloning by amplification of circularized first strand cDNAs reveals non-IRE-regulated iron-responsive mRNAs.
9826564 1998 Intracellular association of FGF-2 with the ribosomal protein L6/TAXREB107.
9582194 1998 A map of 75 human ribosomal protein genes.
9529352 1998 Refined genetic mapping of the darier locus to a <1-cM region of chromosome 12q24.1, and construction of a complete, high-resolution P1 artificial chromosome/bacterial artificial chromosome contig of the critical region.
8722009 Structure and evolution of mammalian ribosomal proteins.
8479925 1993 Sequence of a cDNA encoding human ribosomal protein L26 and of a cDNA probably encoding human ribosomal protein L6.
8457378 1993 Isolation of a cDNA clone encoding DNA-binding protein (TAXREB107) that binds specifically to domain C of the tax-responsive enhancer element in the long terminal repeat of human T-cell leukemia virus type I.
8185817 1994 Isolation of a cDNA whose expression is markedly increased in malignantly transformed FRTL cells and neoplastic human thyroid tissues.
7821789 1994 Construction of a human full-length cDNA bank.
7251593 1981 Characterization of the binding of rat liver ribosomal proteins L6, L8, L19, S9, and S13 to 5.8 S ribosomal ribonucleic acid.
6468376 1984 Location of the sulfhydryl groups involved in disulfide interaction between the neighboring proteins L6 and L29 in mammalian ribosomes. S-cleavage of the cyanylated proteins in polyacrylamide gels after separation by dodecylsulfate gel electrophoresis.