Property Summary

NCBI Gene PubMed Count 78
PubMed Score 74.04
PubTator Score 339.30

Knowledge Summary

Patent

No data available

Expression

Gene RIF (32)

PMID Text
25301064 Ribosomal proteins L11 and L5 activate TAp73 by overcoming MDM2 inhibition.
25132370 RPL5 mutation is associated with Diamond Blackfan Anemia.
24141778 Findings uncover a mechanism by which RPL5 and RPL11 can co-operatively suppress c-Myc expression, allowing a tightly controlled ribosome biogenesis in cells.
24061479 Unlike other tumor suppressors, RPL5 and RPL11 play essential roles in normal cell proliferation.
23478443 Oncogenic splicing factor SRSF1 stabilizes the tumor suppressor protein p53 via RPL5, inducing cell senescence.
23263491 Mutations affect the ribosomal proteins RPL5 and RPL10 in 12 of 122 (9.8%) pediatric T-cell acute lymphoblastic leukemias.
23169665 disrupted nucleoli may provide a platform for L5- and L11-dependent p53 activation, implying a role for the nucleolus in p53 activation by ribosomal biogenesis stress
23125841 Tandem affinity purification and mass spectrometry analysis identify ribosomal protein L5 (RPL5), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22944692 Tandem affinity purification and mass spectrometry analysis identify ribosomal protein L5 (RPL5), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22689679 High frequency of RPL5 gene deletion is associated with Italian Diamond-Blackfan anemia.
22262766 Data show 1 proband with an RPL5 deletion, 1 patient with an RPL35A deletion, 3 with RPS17 deletions, and 1 with an RPS19 deletion.
20554519 Knockdown of L29 or L30 enhanced the interaction of MDM2 with L11 and L5 and markedly inhibited MDM2-mediated p53 ubiquitination, suggesting that direct perturbation of 60 S ribosomal biogenesis activates p53 via L11- and L5-mediated MDM2 suppression.
20378560 Data show that all patients with RPS19 and RPL5 mutations had physical abnormalities.
20378560 Observational study of gene-disease association. (HuGE Navigator)
20368992 Observational study of gene-disease association. (HuGE Navigator)
20087403 An analysis and fine mapping of GFI-EVI5-RPL5-FAM69A locus, genotyping eight Tag-single nucleotide polymorphisms in 732 multiple sclerosis patients and 974 controls from Spain, was performed.
20087403 Observational study of gene-disease association. (HuGE Navigator)
19834503 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19773262 The study reports a high frequency of RPL5 (9.3%) and RPL11 (9.3%) mutations in a Diamond-Blackfan anemia cohort.
19773262 Observational study of gene-disease association. (HuGE Navigator)
19506219 Observational study of gene-disease association. (HuGE Navigator)
19375175 Observational study of gene-disease association. (HuGE Navigator)
19191325 Mutations in RPL5 were identified in eight patients from 6 out of 28 families (21.4%).
19061985 RPL5 mutations are associated with cleft palate and abnormal thumbs in Diamond-Blackfan anemia patients.
18650830 Susceptibility gene for multiple sclerosis in Australians.
18560357 L11 cooperates with L5, resulting in a robust inhibition of the E3 activity of MDM2, and a stabilization and activation of p53 approaching that achieved by p14(ARF).
17242401 5-FU treatment triggers a ribosomal stress response so that ribosomal proteins L5, L11, and L23 are released from ribosome to activate p53 by ablating the MDM2-p53 feedback circuit
17116689 Cancer-associated missense mutations targeting MDM2's central zinc finger disrupt the interaction of MDM2 with L5 and L11.
15469983 interaction of NVL2 with L5 is ATP-dependent and likely contributes to the nucleolar translocation of NVL2
15308643 the MDM2-L5-L11-L23 complex functions to inhibit MDM2-mediated p53 ubiquitination and thus activates p53
11824785 the presence of multiple NLSs in ribosomal protein L5 appears to allow for efficient nuclear transport via utilisation of multiple, mechanistically different import pathways.
9465063 Tandem affinity purification and mass spectrometry analysis identify ribosomal protein L5 (RPL5), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells

AA Sequence

MGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDIICQIAYARIE      1 - 70
GDMIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLNRFGMDKIYEGQVEVTGDEYNVESIDGQPG     71 - 140
AFTCYLDAGLARTTTGNKVFGALKGAVDGGLSIPHSTKRFPGYDSESKEFNAEVHRKHIMGQNVADYMRY    141 - 210
LMEEDEDAYKKQFSQYIKNSVTPDMMEEMYKKAHAAIRENPVYEKKPKKEVKKKRWNRPKMSLAQKKDRV    211 - 280
AQKKASFLRAQERAAES                                                         281 - 297
//

Text Mined References (88)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25301064 2015 Ribosomal proteins L11 and L5 activate TAp73 by overcoming MDM2 inhibition.
25132370 2014 Clinical phenotype and genetic analysis of RPS19, RPL5, and RPL11 genes in Greek patients with Diamond Blackfan Anemia.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24141778 2014 Ribosomal proteins L5 and L11 co-operatively inactivate c-Myc via RNA-induced silencing complex.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24061479 2013 Loss of tumor suppressor RPL5/RPL11 does not induce cell cycle arrest but impedes proliferation due to reduced ribosome content and translation capacity.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23478443 2013 Splicing-factor oncoprotein SRSF1 stabilizes p53 via RPL5 and induces cellular senescence.
23263491 2013 Exome sequencing identifies mutation in CNOT3 and ribosomal genes RPL5 and RPL10 in T-cell acute lymphoblastic leukemia.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23169665 2012 Mutual protection of ribosomal proteins L5 and L11 from degradation is essential for p53 activation upon ribosomal biogenesis stress.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22689679 2012 High frequency of ribosomal protein gene deletions in Italian Diamond-Blackfan anemia patients detected by multiplex ligation-dependent probe amplification assay.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22262766 2012 Extensive gene deletions in Japanese patients with Diamond-Blackfan anemia.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21399665 2011 The balance between rRNA and ribosomal protein synthesis up- and downregulates the tumour suppressor p53 in mammalian cells.
21269460 2011 Initial characterization of the human central proteome.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20554519 2010 Perturbation of 60 S ribosomal biogenesis results in ribosomal protein L5- and L11-dependent p53 activation.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20434207 2010 Transmembrane receptor DCC associates with protein synthesis machinery and regulates translation.
20378560 2010 Mutations in the ribosomal protein genes in Japanese patients with Diamond-Blackfan anemia.
20368992 2010 Multiple sclerosis susceptibility-associated SNPs do not influence disease severity measures in a cohort of Australian MS patients.
20087403 2010 Tag-SNP analysis of the GFI1-EVI5-RPL5-FAM69 risk locus for multiple sclerosis.
19946888 2010 Defining the membrane proteome of NK cells.
19834503 2009 Replication of CD58 and CLEC16A as genome-wide significant risk genes for multiple sclerosis.
19773262 2010 Diamond-Blackfan anemia: genotype-phenotype correlations in Italian patients with RPL5 and RPL11 mutations.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19525955 2009 Genome-wide association study identifies new multiple sclerosis susceptibility loci on chromosomes 12 and 20.
19506219 2009 Risk alleles for multiple sclerosis in multiplex families.
19375175 2009 Fine mapping of multiple sclerosis susceptibility genes provides evidence of allelic heterogeneity at the IL2RA locus.
19191325 2009 Identification of mutations in the ribosomal protein L5 (RPL5) and ribosomal protein L11 (RPL11) genes in Czech patients with Diamond-Blackfan anemia.
19061985 2008 Ribosomal protein L5 and L11 mutations are associated with cleft palate and abnormal thumbs in Diamond-Blackfan anemia patients.
18809582 2008 Nucleophosmin serves as a rate-limiting nuclear export chaperone for the Mammalian ribosome.
18697920 2008 The role of human ribosomal proteins in the maturation of rRNA and ribosome production.
18650830 2008 Replication of KIAA0350, IL2RA, RPL5 and CD58 as multiple sclerosis susceptibility genes in Australians.
18560357 2008 Cooperation between the ribosomal proteins L5 and L11 in the p53 pathway.
17660530 2007 Risk alleles for multiple sclerosis identified by a genomewide study.
17373842 2007 HDM2-binding partners: interaction with translation elongation factor EF1alpha.
17242401 2007 5-fluorouracil activation of p53 involves an MDM2-ribosomal protein interaction.
17116689 2007 Cancer-associated mutations in the MDM2 zinc finger domain disrupt ribosomal protein interaction and attenuate MDM2-induced p53 degradation.
17110929 2006 MDMX regulation of p53 response to ribosomal stress.
16791210 2006 Dynamic proteomics in individual human cells uncovers widespread cell-cycle dependence of nuclear proteins.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16648475 2006 Nucleophosmin is essential for ribosomal protein L5 nuclear export.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15469983 2004 NVL2 is a nucleolar AAA-ATPase that interacts with ribosomal protein L5 through its nucleolar localization sequence.
15308643 2004 Inhibition of MDM2-mediated p53 ubiquitination and degradation by ribosomal protein L5.
15231747 2004 A protein interaction framework for human mRNA degradation.
15189156 2004 The molecular mechanics of eukaryotic translation.
14743126 2004 Endovascular management of juxtarenal aneurysms with fenestrated endovascular grafting.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14667819 2004 Analysis of a high-throughput yeast two-hybrid system and its use to predict the function of intracellular proteins encoded within the human MHC class III region.
14612427 2003 Ribosomal protein L11 negatively regulates oncoprotein MDM2 and mediates a p53-dependent ribosomal-stress checkpoint pathway.
14567916 2003 Regulated release of L13a from the 60S ribosomal subunit as a mechanism of transcript-specific translational control.
12962325 2003 Characterization and analysis of posttranslational modifications of the human large cytoplasmic ribosomal subunit proteins by mass spectrometry and Edman sequencing.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12054647 2002 Up-regulation of PDCD4 in senescent human diploid fibroblasts.
11875025 2002 The human ribosomal protein genes: sequencing and comparative analysis of 73 genes.
11790298 2002 Directed proteomic analysis of the human nucleolus.
11751223 2001 Differential expression of genes coding for ribosomal proteins in different human tissues.
11710515 2001 Mapping of the interaction domain of the protein kinase CKII beta subunit with target proteins.
11410658 2001 The participation of 5S rRNA in the co-translational formation of a eukaryotic 5S ribonucleoprotein complex.
10766838 2000 Human ribosomal protein L5 contains defined nuclear localization and export signals.
10491318 1999 Phosphorylation of ribosomal protein L5 by protein kinase CKII decreases its 5S rRNA binding activity.
10094392 1999 Interactions of protein kinase CK2beta subunit within the holoenzyme and with other proteins.
9738462 1998 p53 and the ribosomal protein L5 participate in high molecular mass complex formation with protein kinase CK2 in murine teratocarcinoma cell line F9 after serum stimulation and cisplatin treatment.
9687515 1998 Importin beta, transportin, RanBP5 and RanBP7 mediate nuclear import of ribosomal proteins in mammalian cells.
9582194 1998 A map of 75 human ribosomal protein genes.
9465063 1998 Interaction of the HIV-1 rev cofactor eukaryotic initiation factor 5A with ribosomal protein L5.
9042965 1997 A-Raf kinase is a new interacting partner of protein kinase CK2 beta subunit.
8806611 1996 Interaction of the beta subunit of casein kinase II with the ribosomal protein L5.
8722009 Structure and evolution of mammalian ribosomal proteins.
8626719 1996 Distinct domains in ribosomal protein L5 mediate 5 S rRNA binding and nucleolar localization.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
8049265 1994 Presence of role of the 5SrRNA-L5 protein complex (5SRNP) in the threonyl- and histidyl-tRNA synthetase complex in rat liver cytosol.
7937132 1994 U21, a novel small nucleolar RNA with a 13 nt. complementarity to 28S rRNA, is encoded in an intron of ribosomal protein L5 gene in chicken and mammals.
7935455 1994 The ribosomal L5 protein is associated with mdm-2 and mdm-2-p53 complexes.
7772601 1995 Cloning, sequencing and expression of the L5, L21, L27a, L28, S5, S9, S10 and S29 human ribosomal protein mRNAs.
7649987 1995 Interaction of the ribosomal protein, L5, with protein phosphatase type 1.
3279045 1988 A 5S rRNA/L5 complex is a precursor to ribosome assembly in mammalian cells.
1712897 1991 Ribosomal protein genes are overexpressed in colorectal cancer: isolation of a cDNA clone encoding the human S3 ribosomal protein.