Property Summary

NCBI Gene PubMed Count 37
PubMed Score 122.81
PubTator Score 274.73

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

AA Sequence

MACARPLISVYSEKGESSGKNVTLPAVFKAPIRPDIVNFVHTNLRKNNRQPYAVSELAGHQTSAESWGTG      1 - 70
RAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKTWRRWHRRVNTTQKRYAICSALAASALPALVMSK     71 - 140
GHRIEEVPELPLVVEDKVEGYKKTKEAVLLLKKLKAWNDIKKVYASQRMRAGKGKMRNRRRIQRRGPCII    141 - 210
YNEDNGIIKAFRNIPGITLLNVSKLNILKLAPGGHVGRFCIWTESAFRKLDELYGTWRKAASLKSNYNLP    211 - 280
MHKMINTDLSRILKSPEIQRALRAPRKKIHRRVLKKNPLKNLRIMLKLNPYAKTMRRNTILRQARNHKLR    281 - 350
VDKAAAAAAALQAKSDEKAAVAGKKPVVGKKGKKAAVGVKKQKKPLVGKKAAATKKPAPEKKPAEKKPTT    351 - 420
EEKKPAA                                                                   421 - 427
//

Text Mined References (51)

PMID Year Title