Property Summary

NCBI Gene PubMed Count 15
PubMed Score 24.71
PubTator Score 16.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
glioblastoma -2.100 4.8e-04
atypical teratoid / rhabdoid tumor -1.700 5.3e-04
medulloblastoma, large-cell 1.100 1.7e-02
acute quadriplegic myopathy 1.835 9.1e-08
intraductal papillary-mucinous adenoma (... -1.400 1.4e-04
intraductal papillary-mucinous carcinoma... -1.100 4.1e-02
intraductal papillary-mucinous neoplasm ... -2.100 2.2e-04
lung cancer -3.900 3.2e-02
cystic fibrosis -1.600 5.4e-05
adult high grade glioma -1.700 3.5e-05
psoriasis -1.200 7.8e-29
subependymal giant cell astrocytoma -1.989 2.6e-02
invasive ductal carcinoma -1.200 6.1e-03
breast carcinoma -1.300 3.1e-26
Breast cancer -1.500 2.0e-12
ovarian cancer -2.500 7.3e-05

Gene RIF (3)

PMID Text
23874713 RPL37, RPS15 and RPS20 regulate the Mdm2-p53-MdmX network but employ different mechanisms to do so.
20935493 Data report that depletion of L37 leads to cell cycle arrest in a MDM2/L11- and p53-dependent manner.
15485924 Transfection revealed more rpL37 mRNA associated with nonphosphorylatable La A(366) than with La S(366), concomitant with La A(366)-specific shift of a fraction of L37 mRNA off polysomes

AA Sequence

MTKGTSSFGKRRNKTHTLCRRCGSKAYHLQKSTCGKCGYPAKRKRKYNWSAKAKRRNTTGTGRMRHLKIV      1 - 70
YRRFRHGFREGTTPKPKRAAVAASSSS                                                71 - 97
//

Text Mined References (24)

PMID Year Title
23874713 2013 Ribosomal proteins RPL37, RPS15 and RPS20 regulate the Mdm2-p53-MdmX network.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20935493 2010 Depletion of ribosomal protein L37 occurs in response to DNA damage and activates p53 through the L11/MDM2 pathway.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15485924 2004 CK2 is responsible for phosphorylation of human La protein serine-366 and can modulate rpL37 5'-terminal oligopyrimidine mRNA metabolism.
15189156 2004 The molecular mechanics of eukaryotic translation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14567916 2003 Regulated release of L13a from the 60S ribosomal subunit as a mechanism of transcript-specific translational control.
12962325 2003 Characterization and analysis of posttranslational modifications of the human large cytoplasmic ribosomal subunit proteins by mass spectrometry and Edman sequencing.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11875025 2002 The human ribosomal protein genes: sequencing and comparative analysis of 73 genes.
11401437 2001 A complete map of the human ribosomal protein genes: assignment of 80 genes to the cytogenetic map and implications for human disorders.
9582194 1998 A map of 75 human ribosomal protein genes.
8722009 Structure and evolution of mammalian ribosomal proteins.
7588717 1995 Cell cycle, differentiation and tissue-independent expression of ribosomal protein L37.
7545944 1994 Human ribosomal protein L37 has motifs predicting serine/threonine phosphorylation and a zinc-finger domain.