Property Summary

NCBI Gene PubMed Count 11
PubMed Score 7.09
PubTator Score 3.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
dermatomyositis 1.100 2.6e-03
ovarian cancer -2.200 3.0e-07
Pneumonia -1.500 7.1e-06
Waldenstrons macroglobulinemia 1.250 2.7e-03

AA Sequence

MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQGRRRYDRKQSGYGGQTKPIFRKKAKTTKKIVLRL      1 - 70
ECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF                                       71 - 106
//

Text Mined References (12)

PMID Year Title