Property Summary

NCBI Gene PubMed Count 22
PubMed Score 6.93
PubTator Score 6.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Pure red-cell aplasia 4 4.043 2.0

Expression

Synonym

Accession P83881 P09896 P10661 Q08ES5 Q5J9I6
Symbols L36A
L44L
MIG6
RPL44

Gene

PDB

4UG0   4V6X   5AJ0  

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

Gene RIF (2)

PMID Text
26362536 HIV-1 Gag interacts with RPL36A as demonstrated by proximity dependent biotinylation proteomics
14752831 RPL36A plays a role in tumor cell proliferation and may be a potential target for anticancer therapy of hepatocellular carcinoma

AA Sequence

MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQGKRRYDRKQSGYGGQTKPIFRKKAKTTKKIVLRL      1 - 70
ECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF                                       71 - 106
//

Text Mined References (23)

PMID Year Title
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
20967262 2010 Expression of conjoined genes: another mechanism for gene regulation in eukaryotes.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15189156 2004 The molecular mechanics of eukaryotic translation.
14752831 2004 Over-expression of the ribosomal protein L36a gene is associated with cellular proliferation in hepatocellular carcinoma.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14567916 2003 Regulated release of L13a from the 60S ribosomal subunit as a mechanism of transcript-specific translational control.
12962325 2003 Characterization and analysis of posttranslational modifications of the human large cytoplasmic ribosomal subunit proteins by mass spectrometry and Edman sequencing.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11401437 2001 A complete map of the human ribosomal protein genes: assignment of 80 genes to the cytogenetic map and implications for human disorders.
10409428 1999 Gene expression in proliferating human erythroid cells.
9110171 1997 Large-scale comparative sequence analysis of the human and murine Bruton's tyrosine kinase loci reveals conserved regulatory domains.
8722009 Structure and evolution of mammalian ribosomal proteins.
8012384 1994 Purification of CpG islands using a methylated DNA binding column.
7959728 1994 Isolation of cosmid and cDNA clones in the region surrounding the BTK gene at Xq21.3-q22.
7821789 1994 Construction of a human full-length cDNA bank.
7626884 1995 Sixty-nine kilobases of contiguous human genomic sequence containing the alpha-galactosidase A and Bruton's tyrosine kinase loci.
3542712 1986 Characterisation of an mRNA encoding a human ribosomal protein homologous to the yeast L44 ribosomal protein.