Property Summary

NCBI Gene PubMed Count 25
PubMed Score 39.12
PubTator Score 16.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Multiple myeloma 1.941 2.7e-03
medulloblastoma, large-cell 1.300 1.8e-04
acute quadriplegic myopathy 1.127 3.1e-04
intraductal papillary-mucinous neoplasm ... -1.300 1.3e-02
lung cancer -2.500 4.7e-02
sonic hedgehog group medulloblastoma 1.500 3.1e-06
ovarian cancer -1.200 1.5e-04

Gene RIF (1)

PMID Text
22029674 RPL36 may be involved in the early stage of hepatocarcinogenesis, and it can be used as an independent and potential prognostic marker for resected hepatocellular carcinoma.

AA Sequence

MALRYPMAVGLNKGHKVTKNVSKPRHSRRRGRLTKHTKFVRDMIREVCGFAPYERRAMELLKVSKDKRAL      1 - 70
KFIKKRVGTHIRAKRKREELSNVLAAMRKAAAKKD                                        71 - 105
//

Text Mined References (30)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22029674 2011 RPL36 as a prognostic marker in hepatocellular carcinoma.
21269460 2011 Initial characterization of the human central proteome.
20562859 2010 Network organization of the human autophagy system.
19946888 2010 Defining the membrane proteome of NK cells.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19061985 2008 Ribosomal protein L5 and L11 mutations are associated with cleft palate and abnormal thumbs in Diamond-Blackfan anemia patients.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16791210 2006 Dynamic proteomics in individual human cells uncovers widespread cell-cycle dependence of nuclear proteins.
16381901 2006 The LIFEdb database in 2006.
16341674 2005 Transcriptome analysis of human gastric cancer.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15635413 2005 Nucleolar proteome dynamics.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15189156 2004 The molecular mechanics of eukaryotic translation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14567916 2003 Regulated release of L13a from the 60S ribosomal subunit as a mechanism of transcript-specific translational control.
12962325 2003 Characterization and analysis of posttranslational modifications of the human large cytoplasmic ribosomal subunit proteins by mass spectrometry and Edman sequencing.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11875025 2002 The human ribosomal protein genes: sequencing and comparative analysis of 73 genes.
11401437 2001 A complete map of the human ribosomal protein genes: assignment of 80 genes to the cytogenetic map and implications for human disorders.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
8722009 Structure and evolution of mammalian ribosomal proteins.