Property Summary

NCBI Gene PubMed Count 32
PubMed Score 17.41
PubTator Score 13.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Gene RIF (9)

PMID Text
23166591 Expression of HIV-1 Tat downregulates the abundance of ribosomal protein L35a (RPL35A) in the nucleoli of Jurkat T-cells
22262766 Data show 1 proband with an RPL5 deletion, 1 patient with an RPL35A deletion, 3 with RPS17 deletions, and 1 with an RPS19 deletion.
22174317 Expression of HIV-1 Tat downregulates the abundance of ribosomal protein L35a (RPL35A) in the nucleoli of Jurkat T-cells
22045982 Studies identified deletions at known Diamond-Blackfan anemia (DBA)-related ribosomal protein gene loci in 17% (9 of 51) of patients without an identifiable mutation, including RPS19, RPS17, RPS26, and RPL35A.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20378560 Observational study of gene-disease association. (HuGE Navigator)
19773262 Observational study of gene-disease association. (HuGE Navigator)
18535205 analysis of 2 Diamond-Blackfan anemia (DBA) patients with chromosome 3q deletions identified RPL35A as a potential DBA gene
12175552 Inhibition of cell death by ribosomal protein L35a.

AA Sequence

MSGRLWSKAIFAGYKRGLRNQREHTALLKIEGVYARDETEFYLGKRCAYVYKAKNNTVTPGGKPNKTRVI      1 - 70
WGKVTRAHGNSGMVRAKFRSNLPAKAIGHRIRVMLYPSRI                                   71 - 110
//

Text Mined References (35)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22262766 2012 Extensive gene deletions in Japanese patients with Diamond-Blackfan anemia.
22045982 2011 Ribosomal protein gene deletions in Diamond-Blackfan anemia.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20378560 2010 Mutations in the ribosomal protein genes in Japanese patients with Diamond-Blackfan anemia.
19946888 2010 Defining the membrane proteome of NK cells.
19773262 2010 Diamond-Blackfan anemia: genotype-phenotype correlations in Italian patients with RPL5 and RPL11 mutations.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18697920 2008 The role of human ribosomal proteins in the maturation of rRNA and ribosome production.
18535205 2008 Abnormalities of the large ribosomal subunit protein, Rpl35a, in Diamond-Blackfan anemia.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15189156 2004 The molecular mechanics of eukaryotic translation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14567916 2003 Regulated release of L13a from the 60S ribosomal subunit as a mechanism of transcript-specific translational control.
12962325 2003 Characterization and analysis of posttranslational modifications of the human large cytoplasmic ribosomal subunit proteins by mass spectrometry and Edman sequencing.
12704204 2003 Differential expression of ribosomal proteins in human normal and neoplastic colorectum.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12175552 2002 Inhibition of cell death by ribosomal protein L35a.
11875025 2002 The human ribosomal protein genes: sequencing and comparative analysis of 73 genes.
10880769 2000 The identification of novel therapeutic targets for the treatment of malignant brain tumors.
9582194 1998 A map of 75 human ribosomal protein genes.
8786106 1996 The human L35a ribosomal protein (RPL35A) gene is located at chromosome band 3q29-qter.
8722009 Structure and evolution of mammalian ribosomal proteins.
7821789 1994 Construction of a human full-length cDNA bank.
2388839 1990 cDNA encoding the human homologue of rat ribosomal protein L35a.
1577483 1992 The mapping of seven intron-containing ribosomal protein genes shows they are unlinked in the human genome.