Property Summary

NCBI Gene PubMed Count 29
PubMed Score 17.85
PubTator Score 33.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
Multiple myeloma 1.146 8.8e-04
malignant mesothelioma 3.300 1.9e-08
psoriasis -2.700 8.4e-05
osteosarcoma -2.278 2.0e-07
group 3 medulloblastoma 2.200 1.6e-05
atypical teratoid / rhabdoid tumor 2.100 4.7e-06
medulloblastoma, large-cell 2.800 1.7e-05
primitive neuroectodermal tumor 1.600 1.0e-03
intraductal papillary-mucinous adenoma (... -1.900 3.7e-03
intraductal papillary-mucinous carcinoma... -1.900 2.3e-02
intraductal papillary-mucinous neoplasm ... -2.900 2.7e-03
lung cancer -3.800 4.3e-02
cystic fibrosis -1.500 1.1e-04
invasive ductal carcinoma -1.359 2.3e-03
Breast cancer -2.200 2.9e-13
ovarian cancer -1.300 3.1e-02
pituitary cancer 1.100 7.5e-03

Gene RIF (2)

PMID Text
25285958 protein levels of the tumor suppressor p53 and its targets, p21 and MDM2, were increased in LNCaP and bicalutamide-resistant LNCaP cells treated with RPL31 siRNA.
25042156 gene discovery in DBA, resulting in the identification of RPL31 as a novel DBA gene.

AA Sequence

MAPAKKGGEKKKGRSAINEVVTREYTINIHKRIHGVGFKKRAPRALKEIRKFAMKEMGTPDVRIDTRLNK      1 - 70
AVWAKGIRNVPYRIRVRLSRKRNEDEDSPNKLYTLVTYVPVTTFKNLQTVNVDEN                    71 - 125
//

Text Mined References (38)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25285958 2014 Short hairpin RNA library-based functional screening identified ribosomal protein L31 that modulates prostate cancer cell growth via p53 pathway.
25042156 2014 Exploiting pre-rRNA processing in Diamond Blackfan anemia gene discovery and diagnosis.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15189156 2004 The molecular mechanics of eukaryotic translation.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14567916 2003 Regulated release of L13a from the 60S ribosomal subunit as a mechanism of transcript-specific translational control.
12962325 2003 Characterization and analysis of posttranslational modifications of the human large cytoplasmic ribosomal subunit proteins by mass spectrometry and Edman sequencing.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11875025 2002 The human ribosomal protein genes: sequencing and comparative analysis of 73 genes.
11790298 2002 Directed proteomic analysis of the human nucleolus.
9582194 1998 A map of 75 human ribosomal protein genes.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8722009 Structure and evolution of mammalian ribosomal proteins.
7821789 1994 Construction of a human full-length cDNA bank.
2780320 1989 cDNA sequence of human ribosomal protein L31.
2597680 1989 Identification of a human ribosomal protein mRNA with increased expression in colorectal tumours.