Property Summary

NCBI Gene PubMed Count 25
PubMed Score 35.09
PubTator Score 28.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
Multiple myeloma 1327 1.3e-04
diabetes mellitus 1663 1.1e-03
lung cancer 4473 4.2e-02
Disease Target Count Z-score Confidence
Lymphangitis 5 3.658 1.8

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.059 1.3e-04
lung cancer -4.000 4.2e-02
diabetes mellitus 2.100 1.1e-03

Gene RIF (4)

PMID Text
22944692 Positional proteomics analysis identifies the cleavage of human 60S ribosomal protein L30 (RPL30) at amino acid residues 92-93 by the HIV-1 protease
22139155 crystal of L30e diffracted to 1.6 A degrees resolution
20554519 Knockdown of L29 or L30 enhanced the interaction of MDM2 with L11 and L5 and markedly inhibited MDM2-mediated p53 ubiquitination, suggesting that direct perturbation of 60 S ribosomal biogenesis activates p53 via L11- and L5-mediated MDM2 suppression.
16968546 Gain of 8q-mapped RPL30 gene is associated with adverse outcome in Medulloblastoma.

AA Sequence

MVAAKKTKKSLESINSRLQLVMKSGKYVLGYKQTLKMIRQGKAKLVILANNCPALRKSEIEYYAMLAKTG      1 - 70
VHHYSGNNIELGTACGKYYRVCTLAIIDPGDSDIIRSMPEQTGEK                              71 - 115
//

Text Mined References (35)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22720776 2012 PHF6 interacts with the nucleosome remodeling and deacetylation (NuRD) complex.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22139155 2011 Crystallization and preliminary X-ray structure analysis of human ribosomal protein L30e.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20554519 2010 Perturbation of 60 S ribosomal biogenesis results in ribosomal protein L5- and L11-dependent p53 activation.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16968546 2006 Medulloblastoma outcome is adversely associated with overexpression of EEF1D, RPL30, and RPS20 on the long arm of chromosome 8.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15189156 2004 The molecular mechanics of eukaryotic translation.
14743216 2004 A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14567916 2003 Regulated release of L13a from the 60S ribosomal subunit as a mechanism of transcript-specific translational control.
12962325 2003 Characterization and analysis of posttranslational modifications of the human large cytoplasmic ribosomal subunit proteins by mass spectrometry and Edman sequencing.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11875025 2002 The human ribosomal protein genes: sequencing and comparative analysis of 73 genes.
9582194 1998 A map of 75 human ribosomal protein genes.
8722009 Structure and evolution of mammalian ribosomal proteins.
7821789 1994 Construction of a human full-length cDNA bank.
1577483 1992 The mapping of seven intron-containing ribosomal protein genes shows they are unlinked in the human genome.