Property Summary

NCBI Gene PubMed Count 29
PubMed Score 26.65
PubTator Score 18.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Multiple myeloma 1.047 4.7e-02
acute quadriplegic myopathy 1.018 2.5e-05
intraductal papillary-mucinous neoplasm ... -1.100 7.0e-03
colon cancer 1.200 1.1e-03
diabetes mellitus -1.400 2.5e-03
mucosa-associated lymphoid tissue lympho... -1.012 6.1e-03
acute myeloid leukemia -1.400 2.7e-02
ovarian cancer -1.400 7.1e-05

Gene RIF (2)

PMID Text
26362536 HIV-1 Gag interacts with RPL28 as demonstrated by proximity dependent biotinylation proteomics
19834535 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSAHLQWMVVRNCSSFLIKRNKQTYSTEPNNLKARNSFRYNGLIHRKTVGVEPAADGKGVVVVIKRRSGQ      1 - 70
RKPATSYVRTTINKNARATLSSIRHMIRKNKYRPDLRMAAIRRASAILRSQKPVMVKRKRTRPTKSS        71 - 137
//

Text Mined References (36)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24912190 2014 Genome-wide RNAi screen identifies the Parkinson disease GWAS risk locus SREBF1 as a regulator of mitophagy.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20434207 2010 Transmembrane receptor DCC associates with protein synthesis machinery and regulates translation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19834535 2009 Sequential use of transcriptional profiling, expression quantitative trait mapping, and gene association implicates MMP20 in human kidney aging.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15189156 2004 The molecular mechanics of eukaryotic translation.
15121898 2004 The composition of Staufen-containing RNA granules from human cells indicates their role in the regulated transport and translation of messenger RNAs.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14567916 2003 Regulated release of L13a from the 60S ribosomal subunit as a mechanism of transcript-specific translational control.
12962325 2003 Characterization and analysis of posttranslational modifications of the human large cytoplasmic ribosomal subunit proteins by mass spectrometry and Edman sequencing.
12704204 2003 Differential expression of ribosomal proteins in human normal and neoplastic colorectum.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11751223 2001 Differential expression of genes coding for ribosomal proteins in different human tissues.
9582194 1998 A map of 75 human ribosomal protein genes.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8722009 Structure and evolution of mammalian ribosomal proteins.
7821789 1994 Construction of a human full-length cDNA bank.
7772601 1995 Cloning, sequencing and expression of the L5, L21, L27a, L28, S5, S9, S10 and S29 human ribosomal protein mRNAs.
4022011 1985 Characterization of the functional gene and several processed pseudogenes in the human triosephosphate isomerase gene family.