Property Summary

NCBI Gene PubMed Count 26
PubMed Score 44.71
PubTator Score 38.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8491 8.7e-05
diabetes mellitus 1663 2.8e-03
lung cancer 4473 4.4e-02

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer -3.700 4.4e-02
diabetes mellitus -1.800 2.8e-03
ovarian cancer -1.100 8.7e-05

Gene RIF (3)

PMID Text
25424902 Loss of function mutations in RPL27 and RPS27 lead to Diamond-Blackfan anaemia.
23166591 Expression of HIV-1 Tat upregulates the abundance of ribosomal protein L27 (RPL27) in the nucleoli of Jurkat T-cells
22174317 Expression of HIV-1 Tat upregulates the abundance of ribosomal protein L27 (RPL27) in the nucleoli of Jurkat T-cells

AA Sequence

MGKFMKPGKVVLVLAGRYSGRKAVIVKNIDDGTSDRPYSHALVAGIDRYPRKVTAAMGKKKIAKRSKIKS      1 - 70
FVKVYNYNHLMPTRYSVDIPLDKTVVNKDVFRDPALKRKARREAKVKFEERYKTGKNKWFFQKLRF         71 - 136
//

Text Mined References (32)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25424902 2015 Loss of function mutations in RPL27 and RPS27 identified by whole-exome sequencing in Diamond-Blackfan anaemia.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21269460 2011 Initial characterization of the human central proteome.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19946888 2010 Defining the membrane proteome of NK cells.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18809582 2008 Nucleophosmin serves as a rate-limiting nuclear export chaperone for the Mammalian ribosome.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15189156 2004 The molecular mechanics of eukaryotic translation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14567916 2003 Regulated release of L13a from the 60S ribosomal subunit as a mechanism of transcript-specific translational control.
12962325 2003 Characterization and analysis of posttranslational modifications of the human large cytoplasmic ribosomal subunit proteins by mass spectrometry and Edman sequencing.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11875025 2002 The human ribosomal protein genes: sequencing and comparative analysis of 73 genes.
11790298 2002 Directed proteomic analysis of the human nucleolus.
11401437 2001 A complete map of the human ribosomal protein genes: assignment of 80 genes to the cytogenetic map and implications for human disorders.
8722009 Structure and evolution of mammalian ribosomal proteins.
8148381 1994 Cloning and nucleotide sequence of a full length cDNA encoding ribosomal protein L27 from human fetal kidney.
7821789 1994 Construction of a human full-length cDNA bank.
7581362 1995 Comparison of the positional cloning methods used to isolate the BRCA1 gene.
7545954 1994 A strong candidate for the breast and ovarian cancer susceptibility gene BRCA1.
1302024 1992 Generation of region- and species-specific expressed gene probes from somatic cell hybrids.