Property Summary

NCBI Gene PubMed Count 23
PubMed Score 42.71
PubTator Score 71.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Anemia, Diamond-Blackfan 15
Disease Target Count Z-score Confidence
Conjunctival cancer 1 3.023 1.5

Expression

Gene RIF (6)

PMID Text
26687066 Six1 regulates p53 via a dual mechanism involving upregulation of microRNA-27a and downregulation of RPL26.
25723396 HIV-1 NC co-localizes with ribosomal protein RPL26 in the cytoplasm
22868929 The results showed that knockdown of RPL26 or RPL29 expression significantly suppressed cell proliferation, induced cell arrest at G0/G1 phase and enhanced cell apoptosis
22433872 suggest a model in which the base pairings in the p53 UTR interaction regions are critical for both translational repression and stress induction of p53 by NCL and RPL26
22431104 Northern Blot Together with RPL5, RPL11, and RPS7, RPL26 is the fourth RP regulating p53 activity that is linked to diamond-blackfan anemia.
18951086 Mdm2 binds L26 and drives its polyubiquitylation and proteasomal degradation.

AA Sequence

MKFNPFVTSDRSKNRKRHFNAPSHIRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKV      1 - 70
VQVYRKKYVIYIERVQREKANGTTVHVGIHPSKVVITRLKLDKDRKKILERKAKSRQVGKEKGKYKEETI     71 - 140
EKMQE                                                                     141 - 145
//

Text Mined References (29)

PMID Year Title
26687066 2015 The Six1 oncoprotein downregulates p53 via concomitant regulation of RPL26 and microRNA-27a-3p.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
22868929 2012 Silencing expression of ribosomal protein L26 and L29 by RNA interfering inhibits proliferation of human pancreatic cancer PANC-1 cells.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22433872 2012 Interactions of nucleolin and ribosomal protein L26 (RPL26) in translational control of human p53 mRNA.
22431104 2012 Frameshift mutation in p53 regulator RPL26 is associated with multiple physical abnormalities and a specific pre-ribosomal RNA processing defect in diamond-blackfan anemia.
21269460 2011 Initial characterization of the human central proteome.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19946888 2010 Defining the membrane proteome of NK cells.
18951086 2008 Mdm2 regulates p53 mRNA translation through inhibitory interactions with ribosomal protein L26.
18697920 2008 The role of human ribosomal proteins in the maturation of rRNA and ribosome production.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15189156 2004 The molecular mechanics of eukaryotic translation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14567916 2003 Regulated release of L13a from the 60S ribosomal subunit as a mechanism of transcript-specific translational control.
12962325 2003 Characterization and analysis of posttranslational modifications of the human large cytoplasmic ribosomal subunit proteins by mass spectrometry and Edman sequencing.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11875025 2002 The human ribosomal protein genes: sequencing and comparative analysis of 73 genes.
11790298 2002 Directed proteomic analysis of the human nucleolus.
11401437 2001 A complete map of the human ribosomal protein genes: assignment of 80 genes to the cytogenetic map and implications for human disorders.
9582194 1998 A map of 75 human ribosomal protein genes.
8722009 Structure and evolution of mammalian ribosomal proteins.
8479925 1993 Sequence of a cDNA encoding human ribosomal protein L26 and of a cDNA probably encoding human ribosomal protein L6.