Property Summary

NCBI Gene PubMed Count 37
PubMed Score 126.65
PubTator Score 94.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.769 1.4e-03
Multiple myeloma 2.092 5.1e-04
intraductal papillary-mucinous neoplasm ... -1.100 2.6e-02
sonic hedgehog group medulloblastoma 1.300 5.9e-05
lung adenocarcinoma -1.700 1.8e-09
invasive ductal carcinoma -1.104 4.4e-05
inflammatory breast cancer -1.500 3.9e-05
ovarian cancer -2.100 1.3e-07

Gene RIF (9)

PMID Text
25196364 considering the high mutation frequency found, our data point toward an important role for RPL22 in microsatellite instability carcinogenesis
24840952 Study revealved that RPL22 binds CK2alpha in lung cancer cells.
23797773 Down-regulation of RPL22 might be involved in the carcinogenesis of NSCLC.
23127973 RPL22 is frequently mutated in MSI-high endometrioid endometrial cancers. The A8 mutation identified was not reported in the whole exome sequences analyzed by the TCGA.
22976955 Rpl22 inactivation promotes neoplastic transformation by inducing expression of Lin28B
19640998 Growth-promoting properties of Epstein-Barr virus EBER-1 RNA correlate with ribosomal protein L22 binding
16564389 The EBER-ISH as an independent prognostic factor of NPC regardless of histopathology.
16556938 Multiple domains of EBER 1 recruit ribosomal protein L22.
15812220 The EBER in situ hybridization showed negative results despite racial or geographical factors might influence the peculiar susceptibility of individuals of Asian ancestry to Epstein-Barr virus-associated lymphoepithelioma-like carcinoma.

AA Sequence

MAPVKKLVVKGGKKKKQVLKFTLDCTHPVEDGIMDAANFEQFLQERIKVNGKAGNLGGGVVTIERSKSKI      1 - 70
TVTSEVPFSKRYLKYLTKKYLKKNNLRDWLRVVANSKESYELRYFQINQDEEEEEDED                 71 - 128
//

Text Mined References (43)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25196364 2014 High frequency of RPL22 mutations in microsatellite-unstable colorectal and endometrial tumors.
24840952 2014 Interaction of ribosomal protein L22 with casein kinase 2?: a novel mechanism for understanding the biology of non-small cell lung cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23797773 2013 Down-regulation of ribosomal protein L22 in non-small cell lung cancer.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23127973 2013 Frequent mutations in the RPL22 gene and its clinical and functional implications.
22976955 2012 Inactivation of ribosomal protein L22 promotes transformation by induction of the stemness factor, Lin28B.
22720776 2012 PHF6 interacts with the nucleosome remodeling and deacetylation (NuRD) complex.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21269460 2011 Initial characterization of the human central proteome.
20562859 2010 Network organization of the human autophagy system.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19640998 2009 Growth-promoting properties of Epstein-Barr virus EBER-1 RNA correlate with ribosomal protein L22 binding.
18809582 2008 Nucleophosmin serves as a rate-limiting nuclear export chaperone for the Mammalian ribosome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16564389 2006 Analysis of prognostic factors of nasopharyngeal carcinoma: impact of in situ hybridization for Epstein-Barr virus encoded small RNA 1.
16556938 2006 Multiple domains of EBER 1, an Epstein-Barr virus noncoding RNA, recruit human ribosomal protein L22.
15812220 2005 EBER expression of pure urinary bladder lymphoepithelioma-like carcinoma in two unique Asian patients.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15189156 2004 The molecular mechanics of eukaryotic translation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14567916 2003 Regulated release of L13a from the 60S ribosomal subunit as a mechanism of transcript-specific translational control.
12962325 2003 Characterization and analysis of posttranslational modifications of the human large cytoplasmic ribosomal subunit proteins by mass spectrometry and Edman sequencing.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11875025 2002 The human ribosomal protein genes: sequencing and comparative analysis of 73 genes.
11790298 2002 Directed proteomic analysis of the human nucleolus.
11401437 2001 A complete map of the human ribosomal protein genes: assignment of 80 genes to the cytogenetic map and implications for human disorders.
11145900 2001 The equine herpesvirus 1 immediate-early protein interacts with EAP, a nucleolar-ribosomal protein.
11056215 2000 An acidic amino acid cluster regulates the nucleolar localization and ribosome assembly of human ribosomal protein L22.
10712515 2000 Identification of two RNA-binding proteins associated with human telomerase RNA.
9847074 1998 Toward a complete human genome sequence.
8722009 Structure and evolution of mammalian ribosomal proteins.
8135813 1994 A novel heparin-binding protein, HBp15, is identified as mammalian ribosomal protein L22.
1846807 1991 EAP, a highly conserved cellular protein associated with Epstein-Barr virus small RNAs (EBERs).