Property Summary

NCBI Gene PubMed Count 26
PubMed Score 18.10
PubTator Score 3.59

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
22944692 Positional proteomics analysis identifies the cleavage of human 60S ribosomal protein L18A (RPL18A) at amino acid residues 127-128 by the HIV-1 protease
16195786 L18a might influence the HCV IRES mediated translation.

AA Sequence

MKASGTLREYKVVGRCLPTPKCHTPPLYRMRIFAPNHVVAKSRFWYFVSQLKKMKKSSGEIVYCGQVFEK      1 - 70
SPLRVKNFGIWLRYDSRSGTHNMYREYRDLTTAGAVTQCYRDMGARHRARAHSIQIMKVEEIAASKCRRP     71 - 140
AVKQFHDSKIKFPLPHRVLRRQHKPRFTTKRPNTFF                                      141 - 176
//

Text Mined References (35)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16195786 2006 Human ribosomal protein L18a interacts with hepatitis C virus internal ribosome entry site.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15635413 2005 Nucleolar proteome dynamics.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15189156 2004 The molecular mechanics of eukaryotic translation.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14567916 2003 Regulated release of L13a from the 60S ribosomal subunit as a mechanism of transcript-specific translational control.
12962325 2003 Characterization and analysis of posttranslational modifications of the human large cytoplasmic ribosomal subunit proteins by mass spectrometry and Edman sequencing.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11875025 2002 The human ribosomal protein genes: sequencing and comparative analysis of 73 genes.
11823430 2002 Importins fulfil a dual function as nuclear import receptors and cytoplasmic chaperones for exposed basic domains.
9582194 1998 A map of 75 human ribosomal protein genes.
8722009 Structure and evolution of mammalian ribosomal proteins.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7821789 1994 Construction of a human full-length cDNA bank.
7662174 1995 The leucine zipper of c-Jun binds to ribosomal protein L18a: a role in Jun protein regulation?
1538749 1992 Sequence identification of 2,375 human brain genes.