Property Summary

NCBI Gene PubMed Count 27
PubMed Score 43.19
PubTator Score 34.68

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

AA Sequence

MVFRRFVEVGRVAYVSFGPHAGKLVAIVDVIDQNRALVDGPCTQVRRQAMPFKCMQLTDFILKFPHSAHQ      1 - 70
KYVRQAWQKADINTKWAATRWAKKIEARERKAKMTDFDRFKVMKAKKMRNRIIKNEVKKLQKAALLKASP     71 - 140
KKAPGTKGTAAAAAAAAAAKVPAKKITAASKKAPAQKVPAQKATGQKAAPAPKAQKGQKAPAQKAPAPKA    141 - 210
SGKKA                                                                     211 - 215
//

Text Mined References (43)

PMID Year Title