Property Summary

NCBI Gene PubMed Count 25
PubMed Score 33.19
PubTator Score 19.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
psoriasis -3.500 4.9e-06
osteosarcoma -3.274 3.0e-10
acute quadriplegic myopathy 1.098 5.7e-08
primary pancreatic ductal adenocarcinoma -1.135 3.0e-03
intraductal papillary-mucinous adenoma (... -1.200 2.2e-03
intraductal papillary-mucinous neoplasm ... -1.500 5.2e-03
colon cancer 1.300 4.1e-03
lung cancer -4.000 2.1e-02
cystic fibrosis -1.100 1.8e-04
adult high grade glioma -1.100 1.5e-03
lung adenocarcinoma -1.100 1.9e-05
invasive ductal carcinoma -1.022 4.0e-04
inflammatory breast cancer -2.000 1.8e-04
ovarian cancer -1.500 5.7e-05

Gene RIF (5)

PMID Text
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of ribosomal protein L13 (RPL13) expression by HIV-1 Vpr in Vpr transduced macrophages
23166591 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of ribosomal protein L13 (RPL13) expression by HIV-1 Vpr in Vpr transduced macrophages
23125841 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of ribosomal protein L13 (RPL13) expression by HIV-1 Vpr in Vpr transduced macrophages
19034380 This protein has been found differentially expressed in the temporal lobe from patients with schizophrenia.
16786168 Ribosomal protein L13 plays an essential role in the progression of some gastrointestinal malignancies.

AA Sequence

MAPSRNGMVLKPHFHKDWQRRVATWFNQPARKIRRRKARQAKARRIAPRPASGPIRPIVRCPTVRYHTKV      1 - 70
RAGRGFSLEELRVAGIHKKVARTIGISVDPRRRNKSTESLQANVQRLKEYRSKLILFPRKPSAPKKGDSS     71 - 140
AEELKLATQLTGPVMPVRNVYKKEKARVITEEEKNFKAFASLRMARANARLFGIRAKRAKEAAEQDVEKK    141 - 210
K//

Text Mined References (36)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24725412 2014 Ribosomal protein s15 phosphorylation mediates LRRK2 neurodegeneration in Parkinson's disease.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19034380 2009 Alterations in oligodendrocyte proteins, calcium homeostasis and new potential markers in schizophrenia anterior temporal lobe are revealed by shotgun proteome analysis.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
16786168 2006 Activation of the ribosomal protein L13 gene in human gastrointestinal cancer.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
15635413 2005 Nucleolar proteome dynamics.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15189156 2004 The molecular mechanics of eukaryotic translation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14567916 2003 Regulated release of L13a from the 60S ribosomal subunit as a mechanism of transcript-specific translational control.
12962325 2003 Characterization and analysis of posttranslational modifications of the human large cytoplasmic ribosomal subunit proteins by mass spectrometry and Edman sequencing.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11997338 2002 Genes in a refined Smith-Magenis syndrome critical deletion interval on chromosome 17p11.2 and the syntenic region of the mouse.
11790298 2002 Directed proteomic analysis of the human nucleolus.
9582194 1998 A map of 75 human ribosomal protein genes.
9114010 1997 Cloning and characterization of human karyopherin beta3.
8722009 Structure and evolution of mammalian ribosomal proteins.
7821789 1994 Construction of a human full-length cDNA bank.
1301162 1992 Isolation and characterization of a novel gene with differential expression in benign and malignant human breast tumours.